BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0158 (533 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 29 0.034 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 3.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 3.9 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 6.8 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 6.8 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 21 9.0 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 28.7 bits (61), Expect = 0.034 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +1 Query: 298 HQRLGSHISGVAALHTWTTGDTHAAFKLSLD-SPQTSSSTGDTHAAFKLSLDSPHASSST 474 H + GS ++G + + +F LSL SP SS H + DSP+ +S Sbjct: 15 HHQSGS-VAGHHHEQSAAAAAAYRSFPLSLGMSPYASSQHHHHHLQARPPQDSPYDASVA 73 Query: 475 GPCKLISA 498 CKL S+ Sbjct: 74 AACKLYSS 81 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 3.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 122 HNPRILADKSTSLTVVPQQASIA 190 +NP I A + SL V Q+ SIA Sbjct: 1407 NNPSISAFRKKSLAYVQQRMSIA 1429 Score = 21.0 bits (42), Expect = 6.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +2 Query: 164 VVPQQASIAASTGPSQPTHRASWSYG 241 V+P + A+S G P H +S+ G Sbjct: 339 VLPGNYANASSVGSRNPIHTSSYMTG 364 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 3.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 122 HNPRILADKSTSLTVVPQQASIA 190 +NP I A + SL V Q+ SIA Sbjct: 1407 NNPSISAFRKKSLAYVQQRMSIA 1429 Score = 21.0 bits (42), Expect = 6.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +2 Query: 164 VVPQQASIAASTGPSQPTHRASWSYG 241 V+P + A+S G P H +S+ G Sbjct: 339 VLPGNYANASSVGSRNPIHTSSYMTG 364 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.0 bits (42), Expect = 6.8 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +3 Query: 228 PGPTAHNFTASSRRNSSSQPTTGSST 305 P P T S +S QPT S+T Sbjct: 399 PEPQPTQTTESEPTQASEQPTESSTT 424 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 6.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +2 Query: 164 VVPQQASIAASTGPSQPTHRASWSYG 241 V+P + A+S G P H +S+ G Sbjct: 106 VLPGNYANASSVGSRNPIHTSSYMTG 131 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 20.6 bits (41), Expect = 9.0 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -2 Query: 487 ACKGQCCSKHAVSRG*A*MLRACRQCCSKS 398 AC G+C S VS + CC +S Sbjct: 64 ACIGRCASYIQVSGSKIWQMERSCMCCQES 93 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,090 Number of Sequences: 336 Number of extensions: 2528 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -