BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0158 (533 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12396| Best HMM Match : Myc-LZ (HMM E-Value=6.2e-10) 40 0.002 SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_42301| Best HMM Match : Keratin_B2 (HMM E-Value=1.2) 34 0.084 SB_2507| Best HMM Match : DUF1168 (HMM E-Value=1.6) 34 0.084 SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.084 SB_36970| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) 33 0.11 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_54819| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_17775| Best HMM Match : Coiled (HMM E-Value=2.3) 31 0.59 SB_46623| Best HMM Match : LEA_2 (HMM E-Value=9.9) 31 0.78 SB_17613| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_38518| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_10451| Best HMM Match : Extensin_2 (HMM E-Value=3.6) 29 1.8 SB_39421| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_4314| Best HMM Match : 4_1_CTD (HMM E-Value=1.8) 29 2.4 SB_2284| Best HMM Match : Hormone_5 (HMM E-Value=0.46) 29 2.4 SB_12271| Best HMM Match : DUF1079 (HMM E-Value=1.2) 29 2.4 SB_18951| Best HMM Match : EGF (HMM E-Value=2.1e-06) 29 3.2 SB_27990| Best HMM Match : DUF229 (HMM E-Value=6.5e-07) 28 4.2 SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_23419| Best HMM Match : zf-A20 (HMM E-Value=1.8e-37) 28 4.2 SB_12590| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_17149| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_58118| Best HMM Match : Somatomedin_B (HMM E-Value=3.7) 27 7.3 SB_53577| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_21884| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_19234| Best HMM Match : Extensin_2 (HMM E-Value=0.23) 27 7.3 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_51999| Best HMM Match : VWA (HMM E-Value=0.045) 27 7.3 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_27693| Best HMM Match : Kringle (HMM E-Value=8.4) 27 7.3 SB_1865| Best HMM Match : DUF1168 (HMM E-Value=5) 27 7.3 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 27 9.6 SB_51578| Best HMM Match : Hormone_5 (HMM E-Value=1.2) 27 9.6 SB_47639| Best HMM Match : Pox_A32 (HMM E-Value=0.075) 27 9.6 SB_39665| Best HMM Match : Pox_A32 (HMM E-Value=0.023) 27 9.6 SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_26513| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 27 9.6 SB_11346| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_55886| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_34910| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_26819| Best HMM Match : L27 (HMM E-Value=9.5) 27 9.6 SB_9820| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_8157| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_7902| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 >SB_12396| Best HMM Match : Myc-LZ (HMM E-Value=6.2e-10) Length = 293 Score = 39.5 bits (88), Expect = 0.002 Identities = 37/113 (32%), Positives = 52/113 (46%), Gaps = 3/113 (2%) Frame = +3 Query: 141 QIKARH*QSSHSKPASQPQQDHRSRLTALPGPTAHNFTASSR-RNSSSQPTTGSSTLGVT 317 Q+ AR+ +SH++ S H +L A +H SS RN+SS TT T G T Sbjct: 141 QLVARN-NTSHTRNNSS----HTEQLIAHTNNWSHTRNNSSHTRNNSSHGTT-HRTHGTT 194 Query: 318 HLRRGSSAH-MDYWRHARSIQAQSRLTADFEQHWRHARSI*AQ-PRLTACFEQ 470 H + +S+H + W H R+ T EQH H + A +L A EQ Sbjct: 195 HHTQNNSSHTRNNWSHTRTTHRTQGTTRRTEQHIAHTEQLIAHTEQLIAHTEQ 247 >SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3051 Score = 35.5 bits (78), Expect = 0.027 Identities = 29/86 (33%), Positives = 40/86 (46%), Gaps = 5/86 (5%) Frame = +3 Query: 99 SASRTSATTIPAFSQIKARH*QSSHSKPASQ----PQQDHRSR-LTALPGPTAHNFTASS 263 S++ TSAT + S + H K S PQ S+ L ++PG + T+SS Sbjct: 393 SSASTSATISISKSSADKSTKKQGHGKGKSNKRMIPQSSTESQVLISVPGSQPQSSTSSS 452 Query: 264 RRNSSSQPTTGSSTLGVTHLRRGSSA 341 NS S P++ SST T SSA Sbjct: 453 SSNSQSSPSSSSSTTSATISISKSSA 478 Score = 33.5 bits (73), Expect = 0.11 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 5/86 (5%) Frame = +3 Query: 99 SASRTSATTIPAFSQIKARH*QSSHSKPASQ----PQQDHRSR-LTALPGPTAHNFTASS 263 S+S TSAT + S + H K + PQ S+ L ++PG + T+SS Sbjct: 463 SSSTTSATISISKSSADKSTRKQGHGKGTNNKRMIPQSSTESQVLISVPGSQPQSSTSSS 522 Query: 264 RRNSSSQPTTGSSTLGVTHLRRGSSA 341 N S P++ SST T SSA Sbjct: 523 SSNLQSSPSSSSSTTSATISISKSSA 548 >SB_42301| Best HMM Match : Keratin_B2 (HMM E-Value=1.2) Length = 600 Score = 33.9 bits (74), Expect = 0.084 Identities = 19/54 (35%), Positives = 34/54 (62%), Gaps = 3/54 (5%) Frame = -1 Query: 503 VRAEISLQGPVLLEAC---GESRLSLNAACVSPVLLEVCGESRLSLNAACVSPV 351 V + +++ +L C G SR+S+N+ +SPV +V G SR+++N+ +SPV Sbjct: 337 VLSRVTINSDILSSVCSDEGLSRVSINSDTLSPVCSDV-GLSRVTINSDILSPV 389 Score = 31.5 bits (68), Expect = 0.45 Identities = 17/52 (32%), Positives = 33/52 (63%), Gaps = 3/52 (5%) Frame = -1 Query: 497 AEISLQGPVLLEAC---GESRLSLNAACVSPVLLEVCGESRLSLNAACVSPV 351 + +++ +L C G SR+S+N+ +SPV +V G SR+++N+ +SP+ Sbjct: 377 SRVTINSDILSPVCSDEGLSRVSINSDILSPVCSDV-GLSRVTINSDILSPL 427 >SB_2507| Best HMM Match : DUF1168 (HMM E-Value=1.6) Length = 305 Score = 33.9 bits (74), Expect = 0.084 Identities = 22/65 (33%), Positives = 35/65 (53%) Frame = +1 Query: 79 QSSDSSSAHQELRLPQSPHSRR*KHVIDSRPTASQHRSLNRTIAADSPRFLVLRHTTSLP 258 Q SD S H++ LP +PH +R KHV+D+ T + H+ ++ I ++ + H T Sbjct: 120 QDSDFSVVHEK-ELPPNPHEQRVKHVVDT--TQAYHQDNDKEIDEENEQ----DHNTRQA 172 Query: 259 HHAAT 273 AAT Sbjct: 173 DSAAT 177 >SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 33.9 bits (74), Expect = 0.084 Identities = 22/65 (33%), Positives = 35/65 (53%) Frame = +1 Query: 79 QSSDSSSAHQELRLPQSPHSRR*KHVIDSRPTASQHRSLNRTIAADSPRFLVLRHTTSLP 258 Q SD S H++ LP +PH +R KHV+D+ T + H+ ++ I ++ + H T Sbjct: 80 QDSDFSVVHEK-ELPPNPHEQRVKHVVDT--TQAYHQDNDKEIDEENEQ----DHNTRQA 132 Query: 259 HHAAT 273 AAT Sbjct: 133 DSAAT 137 >SB_36970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 33.5 bits (73), Expect = 0.11 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 2/129 (1%) Frame = +3 Query: 51 W*PAT*SEHAIF*FIISASRTSATTIPAFSQIKARH*QSSHSKPASQPQQDHRSRLTALP 230 W T +H++ + SA ++ I + + +SH P S+ ++P Sbjct: 242 WRHVTPYQHSVSRHVTSALGATSRNISTWCHV------TSHEHPVSR-------HAISVP 288 Query: 231 GPTAHNFTASSRRNSSSQPTTGSSTLGVTHLRRGSSAHMDYWRHARSIQ--AQSRLTADF 404 G T+H+ S+ ++ S+ T ST GVT + +S H+ WRH S Q +T+ Sbjct: 289 GVTSHHI--STWCHAVSRHVT--STHGVTSHQYLASRHISTWRHVTSHQHLVSRSVTSYH 344 Query: 405 EQHWRHARS 431 WRH S Sbjct: 345 ISTWRHVTS 353 >SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) Length = 509 Score = 33.5 bits (73), Expect = 0.11 Identities = 33/126 (26%), Positives = 50/126 (39%), Gaps = 2/126 (1%) Frame = +1 Query: 97 SAHQELRLPQ-SPHSRR*KHVIDSRPTASQHRSLNRTIAADSPRFLVLRHTTSLPHHAAT 273 S H P+ S H R +H+ P S H L+R + ++ R + H +S HH Sbjct: 246 SRHHHCHRPRLSNHHRPSRHLHCHCPRLSNHHRLSRHLHSNRLRLSIHHHPSSRHHHC-- 303 Query: 274 VHRSPRPDHQRLGSHISGVAALHTWTTGDTHAAFKLSLDSP-QTSSSTGDTHAAFKLSLD 450 HR +H R ++ A + T H +S S Q+S S + + S Sbjct: 304 -HRLRLSNHHRPSRYLHVTALVFPITI--VHLVIFMSPPSSFQSSPSVSSSSLSPPSSFQ 360 Query: 451 SPHASS 468 S H S Sbjct: 361 SYHRPS 366 Score = 31.9 bits (69), Expect = 0.34 Identities = 29/99 (29%), Positives = 40/99 (40%), Gaps = 5/99 (5%) Frame = +1 Query: 19 IFPFVVKTPKTGDLRRDLNTQSSDSSSAHQELRLPQ-SPHSRR*KHVIDSRPTASQHRSL 195 +FPF+ + L + QSS S S H P+ S H R +H RP S H Sbjct: 204 VFPFISSIFSSSSLSPPSSLQSS-SPSRHLHCHRPRLSNHHRPSRHHHCHRPRLSNHHRP 262 Query: 196 NRTIAADSPRFLVLRHTTSLPHHA----ATVHRSPRPDH 300 +R + PR L H S H+ ++H P H Sbjct: 263 SRHLHCHCPR-LSNHHRLSRHLHSNRLRLSIHHHPSSRH 300 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 33.1 bits (72), Expect = 0.15 Identities = 20/57 (35%), Positives = 25/57 (43%) Frame = +3 Query: 174 SKPASQPQQDHRSRLTALPGPTAHNFTASSRRNSSSQPTTGSSTLGVTHLRRGSSAH 344 SK S P R R P P + SSR+ S +PT+ SS L L+ S H Sbjct: 377 SKEKSGPPTPPRHRRNLPPRPVSQMIMPSSRQGRSQEPTSMSSLLAGLSLQSNDSHH 433 >SB_54819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 33.1 bits (72), Expect = 0.15 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 4/78 (5%) Frame = +1 Query: 85 SDSSSAHQELRLPQSPHSRR*KHV-IDSRPTASQHRSLN--RTIAADSPRFLVLRHTTSL 255 S SSS H ++ + +SP S +H+ I P+ HR + R+ ++D R + + + S Sbjct: 43 SPSSSHHPQITIVRSPSSYHHRHITIVISPSIYHHRHITILRSPSSDHHRHITIDISPSS 102 Query: 256 PHHA-ATVHRSPRPDHQR 306 HH T+ SP H R Sbjct: 103 YHHRHMTIVISPSSYHHR 120 >SB_17775| Best HMM Match : Coiled (HMM E-Value=2.3) Length = 877 Score = 31.1 bits (67), Expect = 0.59 Identities = 20/74 (27%), Positives = 31/74 (41%) Frame = +3 Query: 180 PASQPQQDHRSRLTALPGPTAHNFTASSRRNSSSQPTTGSSTLGVTHLRRGSSAHMDYWR 359 P+S QD L A GP + T SS++ S+ S+ HL S + ++ Sbjct: 11 PSSVSSQDIHDALDAFGGPFRNQDTISSKKASNRDSGVSESSFVSDHLTFTSDSLLNEIG 70 Query: 360 HARSIQAQSRLTAD 401 HA + T+D Sbjct: 71 HANQMPISHNKTSD 84 >SB_46623| Best HMM Match : LEA_2 (HMM E-Value=9.9) Length = 196 Score = 30.7 bits (66), Expect = 0.78 Identities = 19/64 (29%), Positives = 35/64 (54%) Frame = -1 Query: 503 VRAEISLQGPVLLEACGESRLSLNAACVSPVLLEVCGESRLSLNAACVSPVVHVCRAATP 324 V ++S++ P+LLE+ E + L + SPVLL+V + + L ++ PV+ +P Sbjct: 113 VLLDVSVKLPMLLESSVELPVLLELSVGSPVLLDVSVKLPVLLESSVELPVLLELSVGSP 172 Query: 323 EMCD 312 + D Sbjct: 173 VLLD 176 Score = 28.3 bits (60), Expect = 4.2 Identities = 18/52 (34%), Positives = 30/52 (57%) Frame = -1 Query: 503 VRAEISLQGPVLLEACGESRLSLNAACVSPVLLEVCGESRLSLNAACVSPVV 348 V ++S++ PVLLE+ E + L + SPVLL+V + + L + PV+ Sbjct: 143 VLLDVSVKLPVLLESSVELPVLLELSVGSPVLLDVSVKLPVLLELSIGLPVL 194 Score = 27.9 bits (59), Expect = 5.5 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = -1 Query: 503 VRAEISLQGPVLLEACGESRLSLNAACVSPVLLEVCGESRLSLNAACVSPVV 348 V E+S+ PVLL+ + + L ++ PVLLE+ S + L+ + PV+ Sbjct: 103 VLLELSVGSPVLLDVSVKLPMLLESSVELPVLLELSVGSPVLLDVSVKLPVL 154 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = -1 Query: 503 VRAEISLQGPVLLEACGESRLSLNAACVSPVLLEVCGESRLSLNAACVSPVV 348 V E+S+ PVLL+ + + L ++ PVLLE+ S + L+ + PV+ Sbjct: 133 VLLELSVGSPVLLDVSVKLPVLLESSVELPVLLELSVGSPVLLDVSVKLPVL 184 Score = 27.1 bits (57), Expect = 9.6 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = -1 Query: 503 VRAEISLQGPVLLEACGESRLSLNAACVSPVLLEVCGESRLSLNAACVSPVV 348 V E+S+ PVLLE +SL PVLLE+ S + L+ + P++ Sbjct: 73 VLLEVSVDLPVLLEVNVGLHVSLEGTVGLPVLLELSVGSPVLLDVSVKLPML 124 >SB_17613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1004 Score = 29.9 bits (64), Expect = 1.4 Identities = 17/79 (21%), Positives = 39/79 (49%), Gaps = 2/79 (2%) Frame = +3 Query: 204 HRSRLTALPGPTAHNFTASSRRNSSSQPTTGSSTLGVTHLRRGSSAHMDYWRHARSIQAQ 383 HR R P + A+ + ++ Q +GS+T H R + + ++RH+ ++ + Sbjct: 885 HRMRRRYGPEHRKRSIKANEQTITARQELSGSATKEWGHFRPSDTMYFRHFRHSETMYFR 944 Query: 384 SRLTAD--FEQHWRHARSI 434 +D + +H+RH+ ++ Sbjct: 945 HFRPSDTMYFRHFRHSETM 963 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 29.9 bits (64), Expect = 1.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 311 GHTSPAWQLCTHGLL 355 GHT P W LC HG L Sbjct: 458 GHTGPVWALCVHGEL 472 >SB_38518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1399 Score = 29.5 bits (63), Expect = 1.8 Identities = 32/115 (27%), Positives = 47/115 (40%), Gaps = 9/115 (7%) Frame = +1 Query: 154 VIDSRPTASQHRSLN-----RTIAADSPRFLVLRHTTSLPH--HAATVHRSPRPDHQRLG 312 VI+ A++ +SLN R+ +PR +LR T+S H AT S + H+ + Sbjct: 741 VIERNDLANEDKSLNVKATRRSKPIAAPRKRILRKTSSRNKIVHGATDGNSSKV-HENVQ 799 Query: 313 SHISGVA--ALHTWTTGDTHAAFKLSLDSPQTSSSTGDTHAAFKLSLDSPHASSS 471 I G A + GD D TSS+ GD D + SS+ Sbjct: 800 VKIDGKTDDAKTSSAHGDVQVKIDDKTDDANTSSAHGDVQVKIDGKTDDANTSSA 854 >SB_10451| Best HMM Match : Extensin_2 (HMM E-Value=3.6) Length = 493 Score = 29.5 bits (63), Expect = 1.8 Identities = 27/104 (25%), Positives = 45/104 (43%) Frame = +1 Query: 190 SLNRTIAADSPRFLVLRHTTSLPHHAATVHRSPRPDHQRLGSHISGVAALHTWTTGDTHA 369 SL RT + +PR + R + P +HR R + L S +A+ TT Sbjct: 321 SLQRTPPSFTPRSSISRRRSDTPTKRRRMHREHRSGERVLLSRRRPASAMGRITTKKKTP 380 Query: 370 AFKLSLDSPQTSSSTGDTHAAFKLSLDSPHASSSTGPCKLISAR 501 +++L T+++ G T A + S S +S + P S+R Sbjct: 381 PRRVNLLEAFTAAAAG-TPAGSRRSSSSSRSSLPSTPRSRTSSR 423 >SB_39421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1810 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = +3 Query: 99 SASRTSATTIPAFSQIKARH*QSSHSKPASQPQQDHRSRLTALPGPTAHNFTASSRRNSS 278 S++ TS+ T+ +S + QS H + S+ H + T PGPT + SSR Sbjct: 1022 SSTITSSDTV--YSPLPNYLGQSKHDEVCSRATPQHANIDTKEPGPTGRSIDPSSRIQEG 1079 Query: 279 SQ 284 S+ Sbjct: 1080 SR 1081 >SB_4314| Best HMM Match : 4_1_CTD (HMM E-Value=1.8) Length = 922 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/69 (27%), Positives = 32/69 (46%) Frame = +1 Query: 283 SPRPDHQRLGSHISGVAALHTWTTGDTHAAFKLSLDSPQTSSSTGDTHAAFKLSLDSPHA 462 SP+P +R SH S +A H +G T + S+ SP++ S S + + Sbjct: 684 SPKPLSRRSSSHASHIAGSHEQLSGQTSSG---SVGSPKSLSQRSRGREGSSASKSNSKS 740 Query: 463 SSSTGPCKL 489 S S+ P ++ Sbjct: 741 SLSSIPIRV 749 >SB_2284| Best HMM Match : Hormone_5 (HMM E-Value=0.46) Length = 1266 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +2 Query: 302 NAWG-HTSPAWQLCTHGLLATRTQHSSSV 385 NA+G HT P QLC G L R + SSSV Sbjct: 858 NAFGTHTCPGEQLCLVGQLGHRARWSSSV 886 >SB_12271| Best HMM Match : DUF1079 (HMM E-Value=1.2) Length = 1716 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +3 Query: 312 VTHLRRGSSAHMDYWRHARSIQAQSRLTADFEQHWRHARSI 434 +T + S DY R + S+++ SR T+D++QH ++ R + Sbjct: 457 LTETKSSVSPEKDY-RGSGSVRSSSRRTSDYQQHDQNGRGV 496 >SB_18951| Best HMM Match : EGF (HMM E-Value=2.1e-06) Length = 1223 Score = 28.7 bits (61), Expect = 3.2 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 5/75 (6%) Frame = +3 Query: 96 ISASRTSATTIPAFSQIKARH*QSSHSKPASQPQQDHRSRLTALPGPTAHNFTAS---SR 266 +++ R + P S + QSSHS P + +S + P P + T+S SR Sbjct: 323 VTSPRATPRASPRASPRASPRDQSSHSSPRNSRNSSRKS--SPKPSPRSSRPTSSRKLSR 380 Query: 267 RNS--SSQPTTGSST 305 ++S SS+PT+G + Sbjct: 381 KSSRKSSRPTSGQQS 395 >SB_27990| Best HMM Match : DUF229 (HMM E-Value=6.5e-07) Length = 887 Score = 28.3 bits (60), Expect = 4.2 Identities = 27/92 (29%), Positives = 37/92 (40%), Gaps = 5/92 (5%) Frame = +1 Query: 154 VIDSRPTASQHRSLNRTIAADSPRFLVLRHTTSLPHHAATVHR--SPRPDHQR---LGSH 318 V+ SR +++ RSL + + +V TSLP T H + D Q + S Sbjct: 17 VLQSRRSSTYSRSLFFVLLLVAVAIVVFFSQTSLPDFMKTSHSKIARSSDDQMDSVVTSQ 76 Query: 319 ISGVAALHTWTTGDTHAAFKLSLDSPQTSSST 414 I A T THA+ K D TS T Sbjct: 77 IDKRALFKVSTKEQTHASMKTQADDGLTSEET 108 >SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2834 Score = 28.3 bits (60), Expect = 4.2 Identities = 25/98 (25%), Positives = 46/98 (46%), Gaps = 4/98 (4%) Frame = +1 Query: 73 NTQSSDSSSAHQELRLPQSPHSRR*KHVIDSR---PTASQHRSLNRTIAADSPRFLVLRH 243 +TQ++ S+++ ++ +P ++ V S P+A+ + ++I A +P + Sbjct: 1939 STQAAPSAASSTQVAPSMAPSTQTGHSVTPSTQAGPSAASCSQVAQSIVATAPPKPTVAS 1998 Query: 244 TT-SLPHHAATVHRSPRPDHQRLGSHISGVAALHTWTT 354 TT P T H S + + + S VAAL T TT Sbjct: 1999 TTYQAPSTTTTTHPSQQTTISLVQAQSSPVAALATQTT 2036 >SB_23419| Best HMM Match : zf-A20 (HMM E-Value=1.8e-37) Length = 1188 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +2 Query: 170 PQQASIAASTGPSQPTH 220 PQ AS+ S G SQPTH Sbjct: 548 PQHASVGTSMGQSQPTH 564 >SB_12590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 28.3 bits (60), Expect = 4.2 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +2 Query: 302 NAWG-HTSPAWQLCTHGLLATRTQHSSSV 385 +A+G HTSP QLC G L R + SSSV Sbjct: 305 HAFGTHTSPGKQLCLVGQLGYRGRWSSSV 333 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 27.9 bits (59), Expect = 5.5 Identities = 17/65 (26%), Positives = 34/65 (52%) Frame = +1 Query: 280 RSPRPDHQRLGSHISGVAALHTWTTGDTHAAFKLSLDSPQTSSSTGDTHAAFKLSLDSPH 459 + P P + +LG + A+ ++W+T D + L+ +S ++ G + ++ S S Sbjct: 1317 QGPNPGNFQLGLRLGFSASGNSWSTQDGMSVSGLTPNSQPWAAPGGPSSSSTPSSDPSAE 1376 Query: 460 ASSST 474 A+SST Sbjct: 1377 AASST 1381 >SB_17149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +1 Query: 376 KLSLDSPQTSSSTGDTHAAFKLSLDSPHASSSTGPCKLISARTTI 510 ++SLD+ +T + FK + H S ST PC L+S R+++ Sbjct: 76 EISLDTC-AEYTTLEAVVTFKTHNELEHKSFSTNPCDLLSYRSSV 119 >SB_58118| Best HMM Match : Somatomedin_B (HMM E-Value=3.7) Length = 306 Score = 27.5 bits (58), Expect = 7.3 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -1 Query: 449 SRLSLNA-ACVSPVLLEVCGESRLSLNAACVS 357 +RL+L+A A +P+ L++CG+ LNA VS Sbjct: 82 ARLTLDAPALKNPIALQLCGDINSPLNALWVS 113 >SB_53577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 382 SLDSPQTSSSTGDTHAAFKLSLDSPHASSST 474 S DSP + S + D+ +++ SLDSP + SS+ Sbjct: 18 SPDSPSSYSPSPDSPSSYSPSLDSPSSYSSS 48 >SB_21884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 27.5 bits (58), Expect = 7.3 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +2 Query: 197 TGPSQPTHRASWSYGTQLHCLITPQQFIAAHDRIINA 307 TG S P+ + Y TQ+ L T Q + AH NA Sbjct: 62 TGSSTPSVSGNTDYSTQIKNLTTELQHLGAHMNFHNA 98 >SB_19234| Best HMM Match : Extensin_2 (HMM E-Value=0.23) Length = 880 Score = 27.5 bits (58), Expect = 7.3 Identities = 29/124 (23%), Positives = 48/124 (38%), Gaps = 6/124 (4%) Frame = +1 Query: 34 VKTPKTGDLRRDLNTQSSDSSSAHQEL-RLPQSPHSRR*KHVIDSRPTASQHRS---LNR 201 +K K RR+ T SS H +L + + ++ KH + AS + L + Sbjct: 246 IKNAKEPKKRRNALTVLEIKSSIHNKLVNIQNTENANHGKHATIRKHAASYRKRATILCK 305 Query: 202 TIAADSPRFLVLRHTTSLPHHAATVHRSPRPDHQRLGSHISGVAALHTWTT--GDTHAAF 375 + + +L S T+H + P H RL A +HT + +HA Sbjct: 306 HATSSNKYATILIELKSNNIEHTTIHNNTSPIHTRLAPIHDKSATIHTMSAPIEPSHAFT 365 Query: 376 KLSL 387 +L L Sbjct: 366 RLQL 369 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 177 KPASQPQQDHRSRLTALPGPTAHNFTASSRRNSSSQPTTGSS 302 K + P+ + TA+PG TA T +S ++ TTG++ Sbjct: 2395 KTTAAPETTSPTETTAVPGTTAAPKTTASPETTAKPDTTGAA 2436 >SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3297 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 177 KPASQPQQDHRSRLTALPGPTAHNFTASSRRNSSSQPTTGSS 302 K + P+ + TA+PG TA T +S ++ TTG++ Sbjct: 2938 KTTAAPETTSPTETTAVPGTTAAPKTTASPETTAKPDTTGAA 2979 >SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 27.5 bits (58), Expect = 7.3 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +1 Query: 154 VIDSRPTAS-QHRSLNRTI-AADSPRFLVLRHTTSLPHHAATVHRSPRPDHQRLGSHISG 327 V++ T S + R+L+ T+ A PR +R S P H+ D + LG Sbjct: 416 VVNENLTISCETRALHVTLPAVFLPRDYAIRIVYSFPAELKRSHQRHLGDLRILGERRFS 475 Query: 328 VAALHTWTTGDT 363 + LH TTG T Sbjct: 476 IVTLHYITTGST 487 >SB_51999| Best HMM Match : VWA (HMM E-Value=0.045) Length = 92 Score = 27.5 bits (58), Expect = 7.3 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +1 Query: 319 ISGVAALHTWTTGDTHAAFKLSLDSPQTSSSTGDTHAAFK 438 + G+A+ T + DTH + DSP + G+ H++++ Sbjct: 34 VKGIASSFTVSPADTHLGLLIYADSPNIEAGLGE-HSSYQ 72 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 27.5 bits (58), Expect = 7.3 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 3/81 (3%) Frame = +1 Query: 91 SSSAHQELRLP--QSPHSRR*KHVI-DSRPTASQHRSLNRTIAADSPRFLVLRHTTSLPH 261 S SA L+ P QSP ++ HV +S +H + I+A + +LR T + H Sbjct: 2999 SHSAPVTLKSPWSQSPTAKWGDHVTAESTAVTQEHDTDKSRISAPT----ILRGITGVAH 3054 Query: 262 HAATVHRSPRPDHQRLGSHIS 324 H +T +S R + LGS +S Sbjct: 3055 HQSTADKSTR-NIAGLGSTLS 3074 >SB_27693| Best HMM Match : Kringle (HMM E-Value=8.4) Length = 146 Score = 27.5 bits (58), Expect = 7.3 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +2 Query: 314 HTSPAWQLCTHGLLATRTQHSSSV 385 HTSP QLC G L R + SSSV Sbjct: 19 HTSPGKQLCFVGQLGYRGRWSSSV 42 >SB_1865| Best HMM Match : DUF1168 (HMM E-Value=5) Length = 289 Score = 27.5 bits (58), Expect = 7.3 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +1 Query: 157 IDSRPTASQHRSLNRTIAADSPRFLVLRHTTSLPHHAATVHRSPRPDHQR 306 +D + +S+ S NRT DS R +T S + H+S +PD R Sbjct: 75 LDEKAISSRTTSANRTRRPDSYRSKNSENTDSHRSRKSESHQSRKPDSHR 124 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = -1 Query: 503 VRAEISLQGPVLLEACGESRLSLNAACVSPVLLEVCGESRL 381 V ++S++ P+LLE+ E + L + SPVLL+ E +L Sbjct: 193 VLLDVSVKLPMLLESSVELPVLLELSVGSPVLLDWLNEHKL 233 >SB_51578| Best HMM Match : Hormone_5 (HMM E-Value=1.2) Length = 622 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +2 Query: 302 NAWG-HTSPAWQLCTHGLLATRTQHSSSV 385 +A+G HT P QLC G L R + SSSV Sbjct: 399 HAFGTHTCPGEQLCLVGQLGHRARWSSSV 427 >SB_47639| Best HMM Match : Pox_A32 (HMM E-Value=0.075) Length = 911 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +2 Query: 302 NAWG-HTSPAWQLCTHGLLATRTQHSSSV 385 +A+G HT P QLC G L R + SSSV Sbjct: 667 HAFGTHTCPGEQLCLVGQLGHRARWSSSV 695 >SB_39665| Best HMM Match : Pox_A32 (HMM E-Value=0.023) Length = 1640 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +2 Query: 302 NAWG-HTSPAWQLCTHGLLATRTQHSSSV 385 +A+G HT P QLC G L R + SSSV Sbjct: 1395 HAFGTHTCPGEQLCLVGQLGHRARWSSSV 1423 >SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6753 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +1 Query: 319 ISGVAALHTWTTGDTHAAFKLSLDSPQTSSSTGDTHAAFK 438 + G+A+ T + DTH + DSP + G+ H++++ Sbjct: 1938 VKGIASSFTVSHADTHLGLLIYADSPNIEAGLGE-HSSYQ 1976 >SB_26513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1460 Score = 27.1 bits (57), Expect = 9.6 Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = +1 Query: 124 QSPHSRR*KHVIDSRPTASQHRSLNRTIAADSPRFLVLRHTTSLP--HHAATVHRSPRPD 297 +S SR V + +P S+H +++ ++++D+P + + T S H T +P D Sbjct: 1054 ESGISRNCSVVSNYKPEVSRHDAVDESVSSDAPALIDGKQTLSESTFHDDGTTDVNPFSD 1113 Query: 298 H 300 H Sbjct: 1114 H 1114 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 27.1 bits (57), Expect = 9.6 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = +1 Query: 55 DLRRDLNTQSSDSSSAHQELRLPQSPHSRR*KHVIDSRPT-ASQHRSLNRTIAADSPRFL 231 D+R L + ++S A QEL L Q + I R T S+ +S ++ + P F Sbjct: 1156 DVRLSLPSTPTESEEAGQELHLLQETQQAEEEQKITRRETKKSKSKSRKKSSSTVRP-FG 1214 Query: 232 VLRHTTS 252 +++HT S Sbjct: 1215 MMKHTKS 1221 >SB_11346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1706 Score = 27.1 bits (57), Expect = 9.6 Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 9/82 (10%) Frame = +3 Query: 123 TIPAFSQIKARH*QSSHSKPASQPQQD---------HRSRLTALPGPTAHNFTASSRRNS 275 T+ + S+IKA SS P S+ Q+D HR R P H A ++ Sbjct: 683 TVVSCSEIKASIPTSSAEDPQSEAQKDSVGSGVNTVHRKRTLVSPEGQTHEVKAFI-EST 741 Query: 276 SSQPTTGSSTLGVTHLRRGSSA 341 S + TT S TL T + R SSA Sbjct: 742 SLENTTPSQTL-KTVMSRTSSA 762 >SB_55886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 582 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +2 Query: 302 NAWG-HTSPAWQLCTHGLLATRTQHSSSV 385 +A+G HT P QLC G L R + SSSV Sbjct: 547 HAFGTHTCPGEQLCLVGQLGHRARWSSSV 575 >SB_34910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2147 Score = 27.1 bits (57), Expect = 9.6 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = +3 Query: 99 SASRTSATTIPAFSQIKARH*QSSHSKPASQPQQDHRSRLTALPGPTAH-NFTASSRRNS 275 S+ TSAT P SQ+ + + S+ S Q+ S++T++ ++ T++++ + Sbjct: 1141 SSQVTSATQEPPSSQVTSVTQEPRSSQVTSATQESRSSQVTSVTQESSSTQVTSATQESR 1200 Query: 276 SSQPTT 293 SSQ T+ Sbjct: 1201 SSQVTS 1206 >SB_26819| Best HMM Match : L27 (HMM E-Value=9.5) Length = 168 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/57 (26%), Positives = 26/57 (45%) Frame = +3 Query: 264 RRNSSSQPTTGSSTLGVTHLRRGSSAHMDYWRHARSIQAQSRLTADFEQHWRHARSI 434 RR S S S+ + +LR S + ++ WR + S+ R + WR + S+ Sbjct: 25 RRESESIVNLWRSSESMVNLREASESMVNLWRSSESMVNLWRSSESMVNLWRSSESM 81 >SB_9820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1060 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -1 Query: 233 TRKRGESAAMVLLRLRCWLAVGRLSMTCFYLRECGDCGSR 114 T+K G + L+R R W+ GR+++ L+ C C R Sbjct: 91 TKKSGREHVLGLIRQRFWIIKGRVTV-LRVLKSCFSCRRR 129 >SB_8157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 405 Score = 27.1 bits (57), Expect = 9.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 230 WSYGTQLHCLITPQQFIAAHDRI 298 WSYG L C P Q + + +R+ Sbjct: 76 WSYGVLLDCKTFPSQHLTSEERV 98 >SB_7902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1020 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 227 SWSYGTQLHCLITPQQFIAAHDRIINAWGHTSPAWQLCTHGLL 355 +W Y H +ITP ++ R+++ G+T+ W + T G L Sbjct: 708 AWFYQYPPHAVITPVLTASSLQRLLHCAGNTN-EWFMLTSGFL 749 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,239,249 Number of Sequences: 59808 Number of extensions: 389302 Number of successful extensions: 1559 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 1265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1535 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -