BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0157 (756 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 4.4 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 23 7.7 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.2 bits (50), Expect = 4.4 Identities = 13/56 (23%), Positives = 22/56 (39%) Frame = +1 Query: 427 VSYFIVWRCCVSKSIICFRLMKFQKLLSSISHMYKLI*LIFSFAKMTSYDLTFL*Y 594 V+Y ++W C V S + R + + M+KL+ + F F Y Sbjct: 1907 VAYQVIWICLVEDSALFLRYVLERLTRDHQDQMFKLLRHLIRFVPRLPQQAAFALY 1962 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 23.4 bits (48), Expect = 7.7 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 2/28 (7%) Frame = -2 Query: 341 VLARGRLE--ARELGRVEQLRDLRELVQ 264 +LAR +++ A+ LGR+E L +LRE V+ Sbjct: 255 LLARYQIDRYAQGLGRIEPLANLREPVR 282 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 640,309 Number of Sequences: 2352 Number of extensions: 10461 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -