BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0157 (756 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-3918|AAF47241.2| 308|Drosophila melanogaster CG3579-PA... 50 3e-06 BT028770-1|ABI34151.1| 94|Drosophila melanogaster GM28229p pro... 29 9.1 >AE013599-3918|AAF47241.2| 308|Drosophila melanogaster CG3579-PA protein. Length = 308 Score = 50.4 bits (115), Expect = 3e-06 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 1/70 (1%) Frame = +3 Query: 165 AASREEYDAHAKLVRAEYSKLTQDNYVELRIKVLNQFSQIPKLFHSPEF-ACFEPAAREN 341 AAS EEY + L+R+EY+ L Y +RIKVL IP ++ + ++ +E AR N Sbjct: 238 AASPEEYKHYTTLLRSEYANLDDATYKAMRIKVLETLLMIPSIYATGDYHDKYEELARAN 297 Query: 342 IEREICTLRE 371 I EI L++ Sbjct: 298 IRNEISELKK 307 >BT028770-1|ABI34151.1| 94|Drosophila melanogaster GM28229p protein. Length = 94 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 231 QDNYVELRIKVLNQFSQIPKLFHSPE 308 Q+N +EL+IK+ + Q K+F SPE Sbjct: 7 QNNKIELKIKISEESDQNGKVFKSPE 32 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,434,986 Number of Sequences: 53049 Number of extensions: 475461 Number of successful extensions: 1003 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1003 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3458330568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -