BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0157 (756 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 27 0.25 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 4.1 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 26.6 bits (56), Expect = 0.25 Identities = 14/61 (22%), Positives = 29/61 (47%) Frame = +3 Query: 186 DAHAKLVRAEYSKLTQDNYVELRIKVLNQFSQIPKLFHSPEFACFEPAARENIEREICTL 365 D HAKLV+A + + T D +++ + ++ + +P F + E ++C L Sbjct: 553 DTHAKLVQAAFEQNTTDQSMDIDVCDNQTYTSLQMAMKNP--IEFTDLSNERKYEDVCVL 610 Query: 366 R 368 + Sbjct: 611 K 611 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 562 MTSYDLTFL*YVCKKKPYK 618 +T +DL FL CKKK K Sbjct: 384 ITMFDLDFLTNACKKKDDK 402 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,472 Number of Sequences: 438 Number of extensions: 3318 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -