BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0156 (718 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1703.15c |vps33|SPBC2A9.01c|vacuolar sorting protein Vps33|S... 42 7e-05 SPCC74.01 |sly1||SNARE binding protein Sly1|Schizosaccharomyces ... 30 0.38 SPAC16A10.03c |||zinc finger protein Pep5/Vps11 |Schizosaccharom... 27 2.0 SPAC7D4.11c |sec39||secretory pathway protein Sec39 |Schizosacch... 25 8.2 SPAC23G3.03 |sib2||ornithine N5 monooxygenase |Schizosaccharomyc... 25 8.2 >SPBC1703.15c |vps33|SPBC2A9.01c|vacuolar sorting protein Vps33|Schizosaccharomyces pombe|chr 2|||Manual Length = 592 Score = 42.3 bits (95), Expect = 7e-05 Identities = 28/126 (22%), Positives = 55/126 (43%) Frame = +1 Query: 166 KKDLIIDPSLIKALERICGVTWLRQHGVDKIYKMDPQLGPTANPNRVYFIPACIIKYKCV 345 KK L+++ L L +I L++HG+ ++Y + + +Y K V Sbjct: 23 KKSLLLERDLSGILGQIVTTNTLQEHGIPQVYWFNENIPNDIEKKTIYLCRPTYENAKLV 82 Query: 346 LDQISSLISQNPSIADVNGFHIIIIPKVLNSFDSILESKGLYGVVKLHAFAWELMVLDDQ 525 + I +I++P F+++L+ +G++G + + + + LD Sbjct: 83 ATHVRQFQRDMLRIEST----VIVLPTSNILFETVLQEEGVFGELLVTEWPLHAVPLDKD 138 Query: 526 LLSLEL 543 LLSLEL Sbjct: 139 LLSLEL 144 >SPCC74.01 |sly1||SNARE binding protein Sly1|Schizosaccharomyces pombe|chr 3|||Manual Length = 639 Score = 29.9 bits (64), Expect = 0.38 Identities = 25/130 (19%), Positives = 56/130 (43%), Gaps = 1/130 (0%) Frame = +1 Query: 169 KDLIIDPSLIKALERICGVTWLRQHGVDKIYKMDPQLGPTANPNRVYFIPACIIKYKCVL 348 K LI D + + + + ++ LR+HGV + P A+ +YF+ + ++ Sbjct: 47 KVLIFDKAGSETISSVLRISDLRKHGVTVHMNITSFRQPIADVPAIYFVQPTQENIELII 106 Query: 349 DQISSLISQNPSIADVNGFHIIIIPKVLNSFDSILESKGLYGVV-KLHAFAWELMVLDDQ 525 + +S + ++ + F I +L F + ++ +++ +VL+ Sbjct: 107 EDLSKGLYESAYVC----FSSTISRALLEQFAELASKTNTSHMIHQVYDQYLNYVVLESD 162 Query: 526 LLSLELPFLF 555 SL+LP +F Sbjct: 163 FFSLQLPKIF 172 >SPAC16A10.03c |||zinc finger protein Pep5/Vps11 |Schizosaccharomyces pombe|chr 1|||Manual Length = 860 Score = 27.5 bits (58), Expect = 2.0 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 2/76 (2%) Frame = -3 Query: 314 IKYTLFGFAVGPSWGSILYILSTPCCLSHVTP--HILSKALIKDGSIIKSFFSPH*LNIF 141 +K+ + ++ + ILY + C + P H+L+ L+KDG++ F P L Sbjct: 697 LKFFVRERSITNKYEDILYKILEACFMQFRIPIQHVLN-ILVKDGTLNFCFLKPLLLKWM 755 Query: 140 CNLFCEISDNDDNLRL 93 + I NDD +++ Sbjct: 756 NDYETRIHQNDDEIQV 771 >SPAC7D4.11c |sec39||secretory pathway protein Sec39 |Schizosaccharomyces pombe|chr 1|||Manual Length = 769 Score = 25.4 bits (53), Expect = 8.2 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 515 RTINSHANACNLTTPYKPLL 456 R +NS NAC+L P+K +L Sbjct: 497 RRLNSLVNACSLIQPFKLIL 516 >SPAC23G3.03 |sib2||ornithine N5 monooxygenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 431 Score = 25.4 bits (53), Expect = 8.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 467 YMVWLNYMHSHG 502 Y +LNY+HSHG Sbjct: 75 YFTFLNYLHSHG 86 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,157,515 Number of Sequences: 5004 Number of extensions: 69266 Number of successful extensions: 164 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -