BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0145 (614 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12396| Best HMM Match : Myc-LZ (HMM E-Value=6.2e-10) 38 0.009 SB_42301| Best HMM Match : Keratin_B2 (HMM E-Value=1.2) 34 0.11 SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_2507| Best HMM Match : DUF1168 (HMM E-Value=1.6) 34 0.11 SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_54819| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_39421| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.42 SB_17613| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.42 SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) 32 0.42 SB_46623| Best HMM Match : LEA_2 (HMM E-Value=9.9) 31 0.56 SB_17775| Best HMM Match : Coiled (HMM E-Value=2.3) 31 0.98 SB_36970| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_4314| Best HMM Match : 4_1_CTD (HMM E-Value=1.8) 30 1.7 SB_10451| Best HMM Match : Extensin_2 (HMM E-Value=3.6) 30 1.7 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_2284| Best HMM Match : Hormone_5 (HMM E-Value=0.46) 29 3.0 SB_12271| Best HMM Match : DUF1079 (HMM E-Value=1.2) 29 3.0 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_41986| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_27990| Best HMM Match : DUF229 (HMM E-Value=6.5e-07) 28 5.2 SB_23419| Best HMM Match : zf-A20 (HMM E-Value=1.8e-37) 28 5.2 SB_12590| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_53577| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 28 6.9 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_26819| Best HMM Match : L27 (HMM E-Value=9.5) 28 6.9 SB_58118| Best HMM Match : Somatomedin_B (HMM E-Value=3.7) 27 9.1 SB_40046| Best HMM Match : TMS_TDE (HMM E-Value=5.5e-07) 27 9.1 SB_21884| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_51999| Best HMM Match : VWA (HMM E-Value=0.045) 27 9.1 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_33200| Best HMM Match : Spc97_Spc98 (HMM E-Value=0.0037) 27 9.1 SB_27693| Best HMM Match : Kringle (HMM E-Value=8.4) 27 9.1 SB_23053| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_11157| Best HMM Match : NUC173 (HMM E-Value=9.2e-39) 27 9.1 >SB_12396| Best HMM Match : Myc-LZ (HMM E-Value=6.2e-10) Length = 293 Score = 37.5 bits (83), Expect = 0.009 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 2/74 (2%) Frame = +2 Query: 338 ASSRRNSSSQPTTGSSTLGVTHLRRGSSAH-MDYWRHARSIQAQSRLTADFEQHWRHARS 514 +S RN+SS TT T G TH + +S+H + W H R+ T EQH H Sbjct: 175 SSHTRNNSSHGTT-HRTHGTTHHTQNNSSHTRNNWSHTRTTHRTQGTTRRTEQHIAHTEQ 233 Query: 515 IQAQ-PRLTASFEQ 553 + A +L A EQ Sbjct: 234 LIAHTEQLIAHTEQ 247 Score = 28.3 bits (60), Expect = 5.2 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 7/85 (8%) Frame = +2 Query: 323 ARNFTASSRRNSSSQPTTGSSTLGVTHLR------RGSSAHMDYWR-HARSIQAQSRLTA 481 ARN T+ +R NSS + T +H R R +S+H R H + Q+ ++ Sbjct: 144 ARNNTSHTRNNSSHTEQLIAHTNNWSHTRNNSSHTRNNSSHGTTHRTHGTTHHTQNN-SS 202 Query: 482 DFEQHWRHARSIQAQPRLTASFEQH 556 +W H R+ T EQH Sbjct: 203 HTRNNWSHTRTTHRTQGTTRRTEQH 227 >SB_42301| Best HMM Match : Keratin_B2 (HMM E-Value=1.2) Length = 600 Score = 33.9 bits (74), Expect = 0.11 Identities = 19/54 (35%), Positives = 34/54 (62%), Gaps = 3/54 (5%) Frame = -2 Query: 586 VRAEISLQGPVLLEAC---GESRLSLNAACVSPVLLEVCGESRLSLNAACVSPV 434 V + +++ +L C G SR+S+N+ +SPV +V G SR+++N+ +SPV Sbjct: 337 VLSRVTINSDILSSVCSDEGLSRVSINSDTLSPVCSDV-GLSRVTINSDILSPV 389 Score = 31.5 bits (68), Expect = 0.56 Identities = 17/52 (32%), Positives = 33/52 (63%), Gaps = 3/52 (5%) Frame = -2 Query: 580 AEISLQGPVLLEAC---GESRLSLNAACVSPVLLEVCGESRLSLNAACVSPV 434 + +++ +L C G SR+S+N+ +SPV +V G SR+++N+ +SP+ Sbjct: 377 SRVTINSDILSPVCSDEGLSRVSINSDILSPVCSDV-GLSRVTINSDILSPL 427 >SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3051 Score = 33.9 bits (74), Expect = 0.11 Identities = 30/86 (34%), Positives = 41/86 (47%), Gaps = 5/86 (5%) Frame = +2 Query: 182 SASRTPATTIPAFSQIKARH*QSSHSKPASQ----PQQDHRSR-LTALPGPTARNFTASS 346 SAS + +I S K+ Q H K S PQ S+ L ++PG ++ T+SS Sbjct: 394 SASTSATISISKSSADKSTKKQG-HGKGKSNKRMIPQSSTESQVLISVPGSQPQSSTSSS 452 Query: 347 RRNSSSQPTTGSSTLGVTHLRRGSSA 424 NS S P++ SST T SSA Sbjct: 453 SSNSQSSPSSSSSTTSATISISKSSA 478 Score = 31.9 bits (69), Expect = 0.42 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 5/86 (5%) Frame = +2 Query: 182 SASRTPATTIPAFSQIKARH*QSSHSKPASQ----PQQDHRSR-LTALPGPTARNFTASS 346 S+S T AT + S + H K + PQ S+ L ++PG ++ T+SS Sbjct: 463 SSSTTSATISISKSSADKSTRKQGHGKGTNNKRMIPQSSTESQVLISVPGSQPQSSTSSS 522 Query: 347 RRNSSSQPTTGSSTLGVTHLRRGSSA 424 N S P++ SST T SSA Sbjct: 523 SSNLQSSPSSSSSTTSATISISKSSA 548 >SB_2507| Best HMM Match : DUF1168 (HMM E-Value=1.6) Length = 305 Score = 33.9 bits (74), Expect = 0.11 Identities = 20/58 (34%), Positives = 33/58 (56%) Frame = +3 Query: 162 QPSDSSSAHQELRLPQSPHSRR*KHVIDSRPTASQHRSLNRTIAADSPRFLVLRHATS 335 Q SD S H++ LP +PH +R KHV+D+ T + H+ ++ I ++ + R A S Sbjct: 120 QDSDFSVVHEK-ELPPNPHEQRVKHVVDT--TQAYHQDNDKEIDEENEQDHNTRQADS 174 >SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 33.9 bits (74), Expect = 0.11 Identities = 20/58 (34%), Positives = 33/58 (56%) Frame = +3 Query: 162 QPSDSSSAHQELRLPQSPHSRR*KHVIDSRPTASQHRSLNRTIAADSPRFLVLRHATS 335 Q SD S H++ LP +PH +R KHV+D+ T + H+ ++ I ++ + R A S Sbjct: 80 QDSDFSVVHEK-ELPPNPHEQRVKHVVDT--TQAYHQDNDKEIDEENEQDHNTRQADS 134 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/57 (35%), Positives = 26/57 (45%) Frame = +2 Query: 257 SKPASQPQQDHRSRLTALPGPTARNFTASSRRNSSSQPTTGSSTLGVTHLRRGSSAH 427 SK S P R R P P ++ SSR+ S +PT+ SS L L+ S H Sbjct: 377 SKEKSGPPTPPRHRRNLPPRPVSQMIMPSSRQGRSQEPTSMSSLLAGLSLQSNDSHH 433 >SB_54819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 33.1 bits (72), Expect = 0.18 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 4/78 (5%) Frame = +3 Query: 168 SDSSSAHQELRLPQSPHSRR*KHV-IDSRPTASQHRSLN--RTIAADSPRFLVLRHATSL 338 S SSS H ++ + +SP S +H+ I P+ HR + R+ ++D R + + + S Sbjct: 43 SPSSSHHPQITIVRSPSSYHHRHITIVISPSIYHHRHITILRSPSSDHHRHITIDISPSS 102 Query: 339 PHHA-ATVHRSPRPDHQR 389 HH T+ SP H R Sbjct: 103 YHHRHMTIVISPSSYHHR 120 >SB_39421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1810 Score = 31.9 bits (69), Expect = 0.42 Identities = 19/63 (30%), Positives = 29/63 (46%) Frame = +2 Query: 179 FSASRTPATTIPAFSQIKARH*QSSHSKPASQPQQDHRSRLTALPGPTARNFTASSRRNS 358 +S S T ++ +S + QS H + S+ H + T PGPT R+ SSR Sbjct: 1019 YSQSSTITSSDTVYSPLPNYLGQSKHDEVCSRATPQHANIDTKEPGPTGRSIDPSSRIQE 1078 Query: 359 SSQ 367 S+ Sbjct: 1079 GSR 1081 >SB_17613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1004 Score = 31.9 bits (69), Expect = 0.42 Identities = 18/79 (22%), Positives = 40/79 (50%), Gaps = 2/79 (2%) Frame = +2 Query: 287 HRSRLTALPGPTARNFTASSRRNSSSQPTTGSSTLGVTHLRRGSSAHMDYWRHARSIQAQ 466 HR R P R+ A+ + ++ Q +GS+T H R + + ++RH+ ++ + Sbjct: 885 HRMRRRYGPEHRKRSIKANEQTITARQELSGSATKEWGHFRPSDTMYFRHFRHSETMYFR 944 Query: 467 SRLTAD--FEQHWRHARSI 517 +D + +H+RH+ ++ Sbjct: 945 HFRPSDTMYFRHFRHSETM 963 >SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) Length = 509 Score = 31.9 bits (69), Expect = 0.42 Identities = 31/120 (25%), Positives = 49/120 (40%), Gaps = 6/120 (5%) Frame = +3 Query: 180 SAHQELRLPQ-SPHSRR*KHVIDSRPTASQHRSLNRTIAADSPRFLVLRHATSLPHHAAT 356 S H P+ S H R +H+ P S H L+R + ++ R + H +S HH Sbjct: 246 SRHHHCHRPRLSNHHRPSRHLHCHCPRLSNHHRLSRHLHSNRLRLSIHHHPSSRHHHC-- 303 Query: 357 VHRSPRPDHQRLGSHISGVAALHTWTTGDTHAAFKLS-----LDSPQTSSSTGDTHAAFK 521 HR +H R ++ A + T H +S SP SSS+ ++F+ Sbjct: 304 -HRLRLSNHHRPSRYLHVTALVFPITI--VHLVIFMSPPSSFQSSPSVSSSSLSPPSSFQ 360 >SB_46623| Best HMM Match : LEA_2 (HMM E-Value=9.9) Length = 196 Score = 31.5 bits (68), Expect = 0.56 Identities = 20/66 (30%), Positives = 36/66 (54%) Frame = -2 Query: 592 SVVRAEISLQGPVLLEACGESRLSLNAACVSPVLLEVCGESRLSLNAACVSPVVHVCRAA 413 S V ++S++ P+LLE+ E + L + SPVLL+V + + L ++ PV+ Sbjct: 111 SPVLLDVSVKLPMLLESSVELPVLLELSVGSPVLLDVSVKLPVLLESSVELPVLLELSVG 170 Query: 412 TPEMCD 395 +P + D Sbjct: 171 SPVLLD 176 Score = 29.1 bits (62), Expect = 3.0 Identities = 19/54 (35%), Positives = 31/54 (57%) Frame = -2 Query: 592 SVVRAEISLQGPVLLEACGESRLSLNAACVSPVLLEVCGESRLSLNAACVSPVV 431 S V ++S++ PVLLE+ E + L + SPVLL+V + + L + PV+ Sbjct: 141 SPVLLDVSVKLPVLLESSVELPVLLELSVGSPVLLDVSVKLPVLLELSIGLPVL 194 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = -2 Query: 586 VRAEISLQGPVLLEACGESRLSLNAACVSPVLLEVCGESRLSLNAACVSPVV 431 V E+S+ PVLL+ + + L ++ PVLLE+ S + L+ + PV+ Sbjct: 103 VLLELSVGSPVLLDVSVKLPMLLESSVELPVLLELSVGSPVLLDVSVKLPVL 154 Score = 27.5 bits (58), Expect = 9.1 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = -2 Query: 586 VRAEISLQGPVLLEACGESRLSLNAACVSPVLLEVCGESRLSLNAACVSPVV 431 V E+S+ PVLL+ + + L ++ PVLLE+ S + L+ + PV+ Sbjct: 133 VLLELSVGSPVLLDVSVKLPVLLESSVELPVLLELSVGSPVLLDVSVKLPVL 184 >SB_17775| Best HMM Match : Coiled (HMM E-Value=2.3) Length = 877 Score = 30.7 bits (66), Expect = 0.98 Identities = 20/74 (27%), Positives = 30/74 (40%) Frame = +2 Query: 263 PASQPQQDHRSRLTALPGPTARNFTASSRRNSSSQPTTGSSTLGVTHLRRGSSAHMDYWR 442 P+S QD L A GP T SS++ S+ S+ HL S + ++ Sbjct: 11 PSSVSSQDIHDALDAFGGPFRNQDTISSKKASNRDSGVSESSFVSDHLTFTSDSLLNEIG 70 Query: 443 HARSIQAQSRLTAD 484 HA + T+D Sbjct: 71 HANQMPISHNKTSD 84 >SB_36970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +2 Query: 380 SSTLGVTHLRRGSSAHMDYWRHARSIQ--AQSRLTADFEQHWRHARSIQ 520 +ST GVT + +S H+ WRH S Q +T+ WRH S Q Sbjct: 307 TSTHGVTSHQYLASRHISTWRHVTSHQHLVSRSVTSYHISTWRHVTSHQ 355 >SB_4314| Best HMM Match : 4_1_CTD (HMM E-Value=1.8) Length = 922 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/69 (27%), Positives = 33/69 (47%) Frame = +3 Query: 366 SPRPDHQRLGSHISGVAALHTWTTGDTHAAFKLSLDSPQTSSSTGDTHAAFKLSLDSPQA 545 SP+P +R SH S +A H +G T + S+ SP++ S S + ++ Sbjct: 684 SPKPLSRRSSSHASHIAGSHEQLSGQTSSG---SVGSPKSLSQRSRGREGSSASKSNSKS 740 Query: 546 SSSTGPCKL 572 S S+ P ++ Sbjct: 741 SLSSIPIRV 749 >SB_10451| Best HMM Match : Extensin_2 (HMM E-Value=3.6) Length = 493 Score = 29.9 bits (64), Expect = 1.7 Identities = 27/104 (25%), Positives = 46/104 (44%) Frame = +3 Query: 273 SLNRTIAADSPRFLVLRHATSLPHHAATVHRSPRPDHQRLGSHISGVAALHTWTTGDTHA 452 SL RT + +PR + R + P +HR R + L S +A+ TT Sbjct: 321 SLQRTPPSFTPRSSISRRRSDTPTKRRRMHREHRSGERVLLSRRRPASAMGRITTKKKTP 380 Query: 453 AFKLSLDSPQTSSSTGDTHAAFKLSLDSPQASSSTGPCKLISAR 584 +++L T+++ G T A + S S ++S + P S+R Sbjct: 381 PRRVNLLEAFTAAAAG-TPAGSRRSSSSSRSSLPSTPRSRTSSR 423 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 394 GHTSPAWQLCTHGLL 438 GHT P W LC HG L Sbjct: 458 GHTGPVWALCVHGEL 472 >SB_2284| Best HMM Match : Hormone_5 (HMM E-Value=0.46) Length = 1266 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +1 Query: 385 NAWG-HTSPAWQLCTHGLLATRTQHSSSV 468 NA+G HT P QLC G L R + SSSV Sbjct: 858 NAFGTHTCPGEQLCLVGQLGHRARWSSSV 886 >SB_12271| Best HMM Match : DUF1079 (HMM E-Value=1.2) Length = 1716 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +2 Query: 395 VTHLRRGSSAHMDYWRHARSIQAQSRLTADFEQHWRHARSI 517 +T + S DY R + S+++ SR T+D++QH ++ R + Sbjct: 457 LTETKSSVSPEKDY-RGSGSVRSSSRRTSDYQQHDQNGRGV 496 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 28.7 bits (61), Expect = 4.0 Identities = 17/65 (26%), Positives = 35/65 (53%) Frame = +3 Query: 363 RSPRPDHQRLGSHISGVAALHTWTTGDTHAAFKLSLDSPQTSSSTGDTHAAFKLSLDSPQ 542 + P P + +LG + A+ ++W+T D + L+ +S ++ G + ++ S S + Sbjct: 1317 QGPNPGNFQLGLRLGFSASGNSWSTQDGMSVSGLTPNSQPWAAPGGPSSSSTPSSDPSAE 1376 Query: 543 ASSST 557 A+SST Sbjct: 1377 AASST 1381 >SB_41986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +3 Query: 276 LNRTIAADSPRFLVLRHATSLPHHAATVHRS-PRPDHQRLGSHISG 410 +N+T+ + L+LR A+ + AT+ +S P+PD G +G Sbjct: 241 VNQTLIPQANHLLILREASIVKESLATLKKSVPKPDDPHQGGDSTG 286 >SB_27990| Best HMM Match : DUF229 (HMM E-Value=6.5e-07) Length = 887 Score = 28.3 bits (60), Expect = 5.2 Identities = 27/92 (29%), Positives = 37/92 (40%), Gaps = 5/92 (5%) Frame = +3 Query: 237 VIDSRPTASQHRSLNRTIAADSPRFLVLRHATSLPHHAATVHR--SPRPDHQR---LGSH 401 V+ SR +++ RSL + + +V TSLP T H + D Q + S Sbjct: 17 VLQSRRSSTYSRSLFFVLLLVAVAIVVFFSQTSLPDFMKTSHSKIARSSDDQMDSVVTSQ 76 Query: 402 ISGVAALHTWTTGDTHAAFKLSLDSPQTSSST 497 I A T THA+ K D TS T Sbjct: 77 IDKRALFKVSTKEQTHASMKTQADDGLTSEET 108 >SB_23419| Best HMM Match : zf-A20 (HMM E-Value=1.8e-37) Length = 1188 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 Query: 253 PQQASIAASTGPSQPTH 303 PQ AS+ S G SQPTH Sbjct: 548 PQHASVGTSMGQSQPTH 564 >SB_12590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +1 Query: 385 NAWG-HTSPAWQLCTHGLLATRTQHSSSV 468 +A+G HTSP QLC G L R + SSSV Sbjct: 305 HAFGTHTSPGKQLCLVGQLGYRGRWSSSV 333 >SB_53577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 465 SLDSPQTSSSTGDTHAAFKLSLDSPQASSST 557 S DSP + S + D+ +++ SLDSP + SS+ Sbjct: 18 SPDSPSSYSPSPDSPSSYSPSLDSPSSYSSS 48 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 27.9 bits (59), Expect = 6.9 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -2 Query: 592 SVVRAEISLQGPVLLEACGESRLSLNAACVSPVLLEVCGESRL 464 S V ++S++ P+LLE+ E + L + SPVLL+ E +L Sbjct: 191 SPVLLDVSVKLPMLLESSVELPVLLELSVGSPVLLDWLNEHKL 233 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +2 Query: 260 KPASQPQQDHRSRLTALPGPTARNFTASSRRNSSSQPTTGSS 385 K + P+ + TA+PG TA T +S ++ TTG++ Sbjct: 2395 KTTAAPETTSPTETTAVPGTTAAPKTTASPETTAKPDTTGAA 2436 >SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3297 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +2 Query: 260 KPASQPQQDHRSRLTALPGPTARNFTASSRRNSSSQPTTGSS 385 K + P+ + TA+PG TA T +S ++ TTG++ Sbjct: 2938 KTTAAPETTSPTETTAVPGTTAAPKTTASPETTAKPDTTGAA 2979 >SB_26819| Best HMM Match : L27 (HMM E-Value=9.5) Length = 168 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/71 (23%), Positives = 30/71 (42%) Frame = +2 Query: 347 RRNSSSQPTTGSSTLGVTHLRRGSSAHMDYWRHARSIQAQSRLTADFEQHWRHARSIQAQ 526 RR S S ++ + +LRR S + ++ WR + S+ + WR + S+ Sbjct: 5 RRASESMENLRRASQSMENLRRESESIVNLWRSSESMVNLREASESMVNLWRSSESMVNL 64 Query: 527 PRLTASFEQHW 559 R + S W Sbjct: 65 WRSSESMVNLW 75 >SB_58118| Best HMM Match : Somatomedin_B (HMM E-Value=3.7) Length = 306 Score = 27.5 bits (58), Expect = 9.1 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -2 Query: 532 SRLSLNA-ACVSPVLLEVCGESRLSLNAACVS 440 +RL+L+A A +P+ L++CG+ LNA VS Sbjct: 82 ARLTLDAPALKNPIALQLCGDINSPLNALWVS 113 >SB_40046| Best HMM Match : TMS_TDE (HMM E-Value=5.5e-07) Length = 383 Score = 27.5 bits (58), Expect = 9.1 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 420 LHTWTTGDTHAAFKLSLDSPQTSSSTGDTHAAFKLSLDSPQ 542 L W D+H ++S DS Q + D+H ++S DS Q Sbjct: 168 LTNWYKDDSHQLVQVSDDSHQLVQVSDDSHQLVQVSDDSHQ 208 >SB_21884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 27.5 bits (58), Expect = 9.1 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 280 TGPSQPTHRASWSYGTQLHCLITPQQFIAAHDRIINA 390 TG S P+ + Y TQ+ L T Q + AH NA Sbjct: 62 TGSSTPSVSGNTDYSTQIKNLTTELQHLGAHMNFHNA 98 >SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 27.5 bits (58), Expect = 9.1 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +3 Query: 237 VIDSRPTAS-QHRSLNRTI-AADSPRFLVLRHATSLPHHAATVHRSPRPDHQRLGSHISG 410 V++ T S + R+L+ T+ A PR +R S P H+ D + LG Sbjct: 416 VVNENLTISCETRALHVTLPAVFLPRDYAIRIVYSFPAELKRSHQRHLGDLRILGERRFS 475 Query: 411 VAALHTWTTGDT 446 + LH TTG T Sbjct: 476 IVTLHYITTGST 487 >SB_51999| Best HMM Match : VWA (HMM E-Value=0.045) Length = 92 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +3 Query: 402 ISGVAALHTWTTGDTHAAFKLSLDSPQTSSSTGDTHAAFK 521 + G+A+ T + DTH + DSP + G+ H++++ Sbjct: 34 VKGIASSFTVSPADTHLGLLIYADSPNIEAGLGE-HSSYQ 72 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 27.5 bits (58), Expect = 9.1 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 3/81 (3%) Frame = +3 Query: 174 SSSAHQELRLP--QSPHSRR*KHVI-DSRPTASQHRSLNRTIAADSPRFLVLRHATSLPH 344 S SA L+ P QSP ++ HV +S +H + I+A + +LR T + H Sbjct: 2999 SHSAPVTLKSPWSQSPTAKWGDHVTAESTAVTQEHDTDKSRISAPT----ILRGITGVAH 3054 Query: 345 HAATVHRSPRPDHQRLGSHIS 407 H +T +S R + LGS +S Sbjct: 3055 HQSTADKSTR-NIAGLGSTLS 3074 >SB_33200| Best HMM Match : Spc97_Spc98 (HMM E-Value=0.0037) Length = 1235 Score = 27.5 bits (58), Expect = 9.1 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = +1 Query: 280 TGPSQPTHRASWSYGTQLHCLITPQQFIAAHDRIINAWGHTSPAWQLCTHGLLATRTQHS 459 T P P R+++ + + T + H R +A+GH S + + LAT+T+HS Sbjct: 662 TSPGHP--RSAYGHPSDSQFQETGVKTSPGHPR--SAFGHPSDSQFQESDSKLATKTKHS 717 Query: 460 SSVSTH 477 SV H Sbjct: 718 MSVHGH 723 >SB_27693| Best HMM Match : Kringle (HMM E-Value=8.4) Length = 146 Score = 27.5 bits (58), Expect = 9.1 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +1 Query: 397 HTSPAWQLCTHGLLATRTQHSSSV 468 HTSP QLC G L R + SSSV Sbjct: 19 HTSPGKQLCFVGQLGYRGRWSSSV 42 >SB_23053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 27.5 bits (58), Expect = 9.1 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +3 Query: 246 SRPTASQHR-SLNRTIAADSPRFLVLRHATSLPHHAATVHRSPRPDH 383 S+ TA H +++ A D P L R A PHH + +S PDH Sbjct: 340 SKRTAPDHTLGVSKRTAPDHPHGLSKRTA---PHHPLGLSKSTAPDH 383 >SB_11157| Best HMM Match : NUC173 (HMM E-Value=9.2e-39) Length = 1060 Score = 27.5 bits (58), Expect = 9.1 Identities = 20/73 (27%), Positives = 28/73 (38%), Gaps = 2/73 (2%) Frame = +1 Query: 262 ASIAASTGPSQPTHRASWSYGTQLHCLITPQQFIAAHDRI--INAWGHTSPAWQLCTHGL 435 A I +ST + TH + T H L TP+ H + H + CTH L Sbjct: 721 APITSSTPQTTSTHHITTPQTTCTHHLTTPETTSTHHISAPQTTSTHHITTPQTTCTHHL 780 Query: 436 LATRTQHSSSVST 474 T + +ST Sbjct: 781 TTPETTCTHHIST 793 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,928,448 Number of Sequences: 59808 Number of extensions: 460086 Number of successful extensions: 1732 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 1457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1710 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -