BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0144 (692 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 23 1.8 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 23 2.4 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 4.1 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 5.5 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 21 9.6 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -1 Query: 467 RVSVKSPLTGLFPIAFDRVVSDCLLTV 387 R V +PLTG+ + + VV+ C T+ Sbjct: 226 RSGVFAPLTGVGTLVVNDVVASCYATI 252 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -3 Query: 681 LFGYWYPMVYCYVRNHFHQQNGTDNNVIKKNCN 583 L+ + Y V CYV + + T++N+I C+ Sbjct: 137 LYIFTYLSVTCYVTYAWSPIDHTESNIINDMCS 169 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 4.1 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 126 EIHATRMRPGLWTVRPAESLSRTRIKRPNLKSALLLSGIP 245 ++H TR P + T AE + NL+ L G P Sbjct: 330 DVHGTRRGPKIKTQPKAEEAKPETLPFLNLQQQLPFPGYP 369 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +3 Query: 183 LSRTRIKRPNLKSALLLSG 239 L+ ++K PNLK+ + + G Sbjct: 86 LNALKVKNPNLKTLIAIGG 104 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 443 TGLFPIAFDRVVSDCLLTV 387 +GL+P A D + LLTV Sbjct: 221 SGLYPSAVDTTTNQKLLTV 239 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,274 Number of Sequences: 336 Number of extensions: 3375 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -