BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0144 (692 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0089 - 17821196-17821306,17821611-17821688,17821801-178218... 28 8.1 >05_04_0089 - 17821196-17821306,17821611-17821688,17821801-17821863, 17822167-17823021,17823121-17823236,17823930-17824004, 17826156-17826213 Length = 451 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +3 Query: 123 EEIHATRMRPGL-WTVRPAESLSRTRIKRPNLKSALLLSGIPLN*TKRPFP 272 EE+ A G W PAESL T +LK++ LL P + PFP Sbjct: 242 EEVPAISAESGHHWKETPAESLFATNALPHSLKTSCLLRENPAILNEIPFP 292 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,265,378 Number of Sequences: 37544 Number of extensions: 369220 Number of successful extensions: 844 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 842 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -