BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0143 (669 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g21630.1 68415.m02573 transport protein, putative similar to ... 31 0.92 At3g53930.1 68416.m05958 protein kinase family protein contains ... 28 6.5 At3g42850.1 68416.m04489 galactokinase, putative contains some s... 27 8.5 At1g13810.1 68414.m01621 expressed protein ; expression supporte... 27 8.5 >At2g21630.1 68415.m02573 transport protein, putative similar to Swiss-Prot:Q15436 protein transport protein Sec23A [Homo sapiens] Length = 761 Score = 30.7 bits (66), Expect = 0.92 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +1 Query: 283 YLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFKNDS 405 Y S+ LP TT+E C++ SP+P V F D+ Sbjct: 95 YSSVADNNLPPELFPHSTTVEYLCDSFSSPSPPVFLFVVDT 135 >At3g53930.1 68416.m05958 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 711 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +1 Query: 316 YAHTPGTTIELTCEAAGSPAPSVHWFKNDSPVYEYDVESNELIDSSPTSIA 468 Y G +++ ++GSP P + FK+ SP E+ ++ N ++P IA Sbjct: 421 YVLISGPPVDIPSSSSGSPKPFNYPFKSHSPPVEF-IKRNVTNLTAPMPIA 470 >At3g42850.1 68416.m04489 galactokinase, putative contains some similarity to galactokinase [Pasteurella multocida] SWISS-PROT:P57899 Length = 964 Score = 27.5 bits (58), Expect = 8.5 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +1 Query: 67 LRIDFAKKEFFLRESHQYYRAVVRMHLVLLFTVAALLGSCQSAHLNKHIKLLSDIDNSIE 246 +R D+ +E FLR+ +YY+ V M LL C + +L + + L D I+ Sbjct: 304 VRRDYFNEEPFLRKMLEYYQGGVEM------IRRDLLAGCWAPYLERAVTLKPCYDGGID 357 Query: 247 NG-VQAK 264 G V AK Sbjct: 358 GGEVAAK 364 >At1g13810.1 68414.m01621 expressed protein ; expression supported by MPSS Length = 303 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +2 Query: 176 WARASPPI*INTLSCFRTSITVLRMVCKQNLMDLINIYRSRKAPY 310 W ASP IN + TS VL + C + D +Y +K PY Sbjct: 146 WLGASPDGVINVVKDGVTSCGVLEVKCPFDNRDNSKVYPWKKVPY 190 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,436,889 Number of Sequences: 28952 Number of extensions: 234429 Number of successful extensions: 597 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 597 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -