BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0142 (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 25 0.75 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 9.2 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 25.0 bits (52), Expect = 0.75 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 5/37 (13%) Frame = -3 Query: 702 RCPRSHPWVRRHHGTAYSKPC-----TCHDGGRISPS 607 +CPR H V +G Y+ C CH G ++ S Sbjct: 109 KCPRRHRPVCASNGKIYANHCELHRAACHSGSSLTKS 145 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.4 bits (43), Expect = 9.2 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 67 ESASSLTSVPVCKDS*SSTPSVEVPALGSLPY*WS 171 +S SS V ++S SS+PS+++ G L WS Sbjct: 357 QSQSSPKFVARREESNSSSPSLDLGKEGGLEAQWS 391 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,047 Number of Sequences: 438 Number of extensions: 5019 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -