BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0139 (707 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. 30 0.016 AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A prot... 30 0.016 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 30 0.016 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 23 3.2 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 7.4 >X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. Length = 133 Score = 30.3 bits (65), Expect = 0.016 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 595 LRKSERRIKELTFQAEEDRKNHERMQDLVDKLQQKIK 705 L+K R +KE+ QA +R+ ER + + QQKI+ Sbjct: 61 LKKELRAVKEINEQARREREEQERHKQQQQEKQQKIE 97 >AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A protein. Length = 284 Score = 30.3 bits (65), Expect = 0.016 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 595 LRKSERRIKELTFQAEEDRKNHERMQDLVDKLQQKIK 705 L+K R +KE+ QA +R+ ER + + QQKI+ Sbjct: 212 LKKELRAVKEINEQARREREEQERHKQQQQEKQQKIE 248 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 30.3 bits (65), Expect = 0.016 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 595 LRKSERRIKELTFQAEEDRKNHERMQDLVDKLQQKIK 705 L+K R +KE+ QA +R+ ER + + QQKI+ Sbjct: 271 LKKELRAVKEINEQARREREEQERHKQQQQEKQQKIE 307 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/41 (21%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 436 EQQIKELQVRL-DEAEANALKGGKKAIQKLEQRVRELENEL 555 +Q++ + +++ + ++ KKA+QKL + V + + +L Sbjct: 61 DQKVMDYFIKMVKQKHKKDIRADKKALQKLRREVEKAKRDL 101 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 135 RVPHTLGAGRPRPSPGRA 188 +VP G GR P P R+ Sbjct: 320 QVPQLAGGGRRGPGPARS 337 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.310 0.126 0.317 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,750 Number of Sequences: 336 Number of extensions: 1225 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -