BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0139 (707 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 3.7 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 5.0 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 243 PLCRQEETRVRAANPAL 293 P CR++ + AANP L Sbjct: 99 PSCRRQRYNIAAANPLL 115 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 5.0 Identities = 14/61 (22%), Positives = 29/61 (47%) Frame = +1 Query: 445 IKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRIKE 624 +K ++ D+++ K +QK + ++E ENE+D + D K+ ++ E Sbjct: 487 LKNTEIFKDKSDWFDYSEVSKWVQKGQICLKEKENEIDFKIEVTEDCNKSFNDLLTQVAE 546 Query: 625 L 627 L Sbjct: 547 L 547 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.310 0.126 0.317 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,021 Number of Sequences: 438 Number of extensions: 1537 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -