BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0136 (557 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q75C93 Cluster: ACR023Wp; n=1; Eremothecium gossypii|Re... 33 3.4 UniRef50_Q4P5F7 Cluster: Putative uncharacterized protein; n=1; ... 33 6.0 >UniRef50_Q75C93 Cluster: ACR023Wp; n=1; Eremothecium gossypii|Rep: ACR023Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 769 Score = 33.5 bits (73), Expect = 3.4 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +2 Query: 8 PRPSDPKPTSPARGAPCRSTNEALARRGRH 97 P P DP+PTSPA+ A R ++ +L G H Sbjct: 550 PPPGDPQPTSPAQNATRRPSDASLGYPGSH 579 >UniRef50_Q4P5F7 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 897 Score = 32.7 bits (71), Expect = 6.0 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +2 Query: 17 SDPKPTSPARGAPCRSTNEALARRGRHGTTVAYIVXDSGSDHK 145 +DP P+SP P + EA+AR + + V IV +G D++ Sbjct: 348 ADPNPSSPTHSRPAANWTEAIARIEKLDSYVRRIVFQAGLDYE 390 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 492,441,710 Number of Sequences: 1657284 Number of extensions: 8510890 Number of successful extensions: 21472 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21420 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 37071859483 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -