BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0136 (557 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0183 + 17642639-17643428,17644507-17644949 30 1.1 01_01_0564 - 4152189-4153643 27 7.7 >06_03_0183 + 17642639-17643428,17644507-17644949 Length = 410 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 5 LPRPSDPKPTSPARGAPCRSTN-EALARRGRHGTTVAYIVXDSG 133 LPR D + + R P ST+ EA ARR R A+++ DSG Sbjct: 358 LPRQRDARSIAHLRCEPAASTSPEAAARRRRLVQATAWLLWDSG 401 >01_01_0564 - 4152189-4153643 Length = 484 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -2 Query: 103 GSVTTTPRQSLVC*SAGCAASRRGWLWIRR 14 GS++T R+ + S G AAS R +LW+ R Sbjct: 314 GSLSTMSRRQIAEVSRGMAASGRPFLWVLR 343 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,975,754 Number of Sequences: 37544 Number of extensions: 224597 Number of successful extensions: 635 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 617 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 632 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1269546012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -