BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0136 (557 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006683-1|AAK71395.4| 954|Caenorhabditis elegans Adenylyl cycl... 27 9.1 >AC006683-1|AAK71395.4| 954|Caenorhabditis elegans Adenylyl cyclase protein 4 protein. Length = 954 Score = 27.1 bits (57), Expect = 9.1 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%) Frame = +3 Query: 222 VILTPFHFYI---RLVKHFQ*YGLLSKALGVXFILIVIICVNVSPKYGSDTLINLGYCLK 392 ++LT +I L+KH + L+S +GV FIL+ I V + Y S ++ C K Sbjct: 557 IVLTSVMIFILTRALIKHAR---LVSLVIGVLFILLSIQIVILMGMYESKFTCDVEKCFK 613 Query: 393 SLVSTFLQ 416 + + F + Sbjct: 614 NNYTDFFE 621 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,145,001 Number of Sequences: 27780 Number of extensions: 196435 Number of successful extensions: 448 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 448 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1144922904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -