BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0134 (734 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 22 6.9 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 22 6.9 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 22 6.9 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 22 6.9 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 9.1 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 9.1 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 9.1 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 9.1 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 9.1 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 9.1 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 9.1 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.8 bits (44), Expect = 6.9 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +1 Query: 562 NSNSKFKLSQ*CCTVRSFLPDVSTS 636 N +FK + CC PDV ++ Sbjct: 47 NELGRFKHTDACCRTHDMCPDVMSA 71 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.8 bits (44), Expect = 6.9 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +1 Query: 562 NSNSKFKLSQ*CCTVRSFLPDVSTS 636 N +FK + CC PDV ++ Sbjct: 52 NELGRFKHTDACCRTHDMCPDVMSA 76 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.8 bits (44), Expect = 6.9 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +1 Query: 562 NSNSKFKLSQ*CCTVRSFLPDVSTS 636 N +FK + CC PDV ++ Sbjct: 52 NELGRFKHTDACCRTHDMCPDVMSA 76 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.8 bits (44), Expect = 6.9 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -2 Query: 172 VDISAVLNCRHISKWYTS 119 VDIS ++N R+ +K YTS Sbjct: 516 VDISKLVNKRNNAKIYTS 533 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 200 DPLPPFNGKLRVYNMRYCPYAQRTILALNAK 292 DPL P + LR+Y Y R L L+ + Sbjct: 157 DPLIPVHFALRIYRNGTVNYLMRRHLILSCQ 187 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 200 DPLPPFNGKLRVYNMRYCPYAQRTILALNAK 292 DPL P + LR+Y Y R L L+ + Sbjct: 157 DPLIPVHFALRIYRNGTVNYLMRRHLILSCQ 187 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 200 DPLPPFNGKLRVYNMRYCPYAQRTILALNAK 292 DPL P + LR+Y Y R L L+ + Sbjct: 208 DPLIPVHFALRIYRNGTVNYLMRRHLILSCQ 238 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 200 DPLPPFNGKLRVYNMRYCPYAQRTILALNAK 292 DPL P + LR+Y Y R L L+ + Sbjct: 157 DPLIPVHFALRIYRNGTVNYLMRRHLILSCQ 187 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +2 Query: 230 RVYNMRYCPYAQRTILALNAKQID 301 R + +RY PY QR + + ++D Sbjct: 462 RPFEVRYDPYTQRVEILDSVDRLD 485 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +2 Query: 284 NAKQIDYEVVNIDLIDKP 337 N+K++ Y ++NI+ I P Sbjct: 319 NSKKLYYNIINIEQIPVP 336 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +2 Query: 284 NAKQIDYEVVNIDLIDKP 337 N+K++ Y ++NI+ I P Sbjct: 330 NSKKLYYNIINIEQIPVP 347 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,025 Number of Sequences: 438 Number of extensions: 3558 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -