BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0130 (666 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0621 - 4511583-4512116,4512307-4512719,4513236-4513482 28 5.8 06_01_0618 - 4492057-4492590,4492780-4493192,4493714-4494026,449... 28 5.8 >06_01_0621 - 4511583-4512116,4512307-4512719,4513236-4513482 Length = 397 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = -2 Query: 503 SKISSLVLVHTTLIFIDAFVMPMNCLLPAQPFRKPALSLDELVTSTVYIKKQ 348 SKI ++ LI + ++ ++ +L A+ R SLD+L+ + Y+ Q Sbjct: 91 SKIVVVIWCFVVLILVQSYTASLSSMLTAKRLRPSVKSLDQLLLTGDYVGYQ 142 >06_01_0618 - 4492057-4492590,4492780-4493192,4493714-4494026, 4495257-4495828,4498324-4498600 Length = 702 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = -2 Query: 503 SKISSLVLVHTTLIFIDAFVMPMNCLLPAQPFRKPALSLDELVTSTVYIKKQ 348 SKI ++ LI + ++ ++ +L A+ R SLD+L+ + Y+ Q Sbjct: 396 SKIVVVIWCFVVLILVQSYTASLSSMLTAKRLRPSVKSLDQLLLTGDYVGYQ 447 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,566,888 Number of Sequences: 37544 Number of extensions: 254045 Number of successful extensions: 394 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 394 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -