BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0130 (666 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) 31 1.1 >SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) Length = 509 Score = 30.7 bits (66), Expect = 1.1 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = -2 Query: 530 IRMILVTLNSKISSLVLVHTTLIFIDAFVMPM 435 I +++ T+ + + S++ VH ++FI A V P+ Sbjct: 142 IHLVIFTVTALVFSIIFVHVVVVFITALVFPI 173 Score = 28.3 bits (60), Expect = 5.9 Identities = 8/31 (25%), Positives = 20/31 (64%) Frame = -2 Query: 530 IRMILVTLNSKISSLVLVHTTLIFIDAFVMP 438 + +++ T+ + +S +++VH + + AFV P Sbjct: 176 VHLVIFTVTALVSPIIIVHLVIFTLTAFVFP 206 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,839,680 Number of Sequences: 59808 Number of extensions: 323812 Number of successful extensions: 574 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -