BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0130 (666 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 6.0 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 8.0 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 21 8.0 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 8.0 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 375 NIYCVYKKTKMCVSGRLTEVIT 310 NI Y KT C+SGR +V+T Sbjct: 292 NIVTSYCKT--CISGRAFQVLT 311 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 22 SDNCLWEGRSLRYVTRYGVSLSGFSFSLAY 111 S+N W G + + +T G+S G S Y Sbjct: 190 SENIEWFGGNPKRITLIGLSAGGASVHYHY 219 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 22 SDNCLWEGRSLRYVTRYGVSLSGFSFSLAY 111 S+N W G + + +T G+S G S Y Sbjct: 61 SENIEWFGGNPKRITLIGLSAGGASVHYHY 90 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 22 SDNCLWEGRSLRYVTRYGVSLSGFSFSLAY 111 S+N W G + + +T G+S G S Y Sbjct: 190 SENIEWFGGNPKRITLIGLSAGGASVHYHY 219 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,934 Number of Sequences: 438 Number of extensions: 3215 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -