BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0130 (666 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06830.1 68416.m00810 pectinesterase family protein contains ... 29 2.8 >At3g06830.1 68416.m00810 pectinesterase family protein contains Pfam profiles: PF01095 pectinesterase,PF04043 plant invertase/pectin methylesterase inhibitor Length = 568 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = -1 Query: 492 LFGSCSHDAHLH*CFCHAHELFITSTTVPQTGTFP*RAGNIYCVYKKTKMCV 337 +F SC D H + H+H F TV +GT G+ C+ + K+ V Sbjct: 375 VFHSCQIDGHQDTLYVHSHRQFYRDCTV--SGTVDFIFGDAKCILQNCKIVV 424 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,528,983 Number of Sequences: 28952 Number of extensions: 230347 Number of successful extensions: 427 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 427 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -