BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0117 (623 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08310.1 68417.m01372 expressed protein glutamic acid-rich pr... 32 0.36 At4g19230.2 68417.m02837 cytochrome P450 family protein cytochro... 31 0.47 At5g17930.1 68418.m02102 MA3 domain-containing protein low simil... 31 0.82 At3g19900.1 68416.m02520 expressed protein 29 1.9 At5g17240.1 68418.m02020 SET domain-containing protein contains ... 29 2.5 At4g02710.1 68417.m00366 kinase interacting family protein simil... 29 3.3 At3g20860.1 68416.m02637 protein kinase family protein contains ... 29 3.3 At5g64710.2 68418.m08135 expressed protein contains Pfam profile... 28 4.4 At5g64710.1 68418.m08134 expressed protein contains Pfam profile... 28 4.4 At5g31412.1 68418.m03722 hypothetical protein contains Pfam doma... 28 4.4 At3g04810.2 68416.m00521 protein kinase, putative similar to LST... 28 4.4 At3g04810.1 68416.m00520 protein kinase, putative similar to LST... 28 4.4 At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-contai... 28 4.4 At5g28290.1 68418.m03434 protein kinase, putative similar to LST... 28 5.8 At2g26780.1 68415.m03212 expressed protein contains Pfam profile... 27 7.7 At2g04230.1 68415.m00410 F-box family protein contains F-box dom... 27 7.7 >At4g08310.1 68417.m01372 expressed protein glutamic acid-rich protein precursor - Plasmodium falciparum, PIR2:A54514 Length = 504 Score = 31.9 bits (69), Expect = 0.36 Identities = 21/59 (35%), Positives = 30/59 (50%) Frame = +1 Query: 73 DEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGK 249 D K +K+H CL+ + DE N L+T + K + P+K+ A L K KDGK Sbjct: 77 DVHKSFVKQHLVQCLAGAENDETSENSLET-EKKDDVTPVKEAA--ELSKEHTTKKDGK 132 >At4g19230.2 68417.m02837 cytochrome P450 family protein cytochrome P450, Arabidopsis thaliana; supported by cDNA: gi_15293092_gb_AY050980.1_ Length = 484 Score = 31.5 bits (68), Expect = 0.47 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -2 Query: 409 ERASGLSRGSISHNSRLFGEGCCLCWPGKRQS 314 ERA+G S G +SR C LCWPG R+S Sbjct: 439 ERATGFSMG----HSRFPKTDCPLCWPGSRRS 466 >At5g17930.1 68418.m02102 MA3 domain-containing protein low similarity to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profile PF02847: MA3 domain Length = 707 Score = 30.7 bits (66), Expect = 0.82 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 2/104 (1%) Frame = +1 Query: 106 ADCLSETKADE--QLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGKFKKDVALAKV 279 A+ ++ET E + LK + + N +K C+++ S+ F+K + L + Sbjct: 479 AEDIAETMDAEVVEAQKMLKLAEAQRMNTDSRKAIFCVIMSSEDYID--AFEKLLRL-DL 535 Query: 280 PNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPKHAL 411 P +D+ + L++ CL K + T C H+K+ K L Sbjct: 536 PGKQDREIMRVLVECCLQEKAFNKFYTVLASKLCEHDKNHKFTL 579 >At3g19900.1 68416.m02520 expressed protein Length = 222 Score = 29.5 bits (63), Expect = 1.9 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -3 Query: 159 LQFVHQLFISFRLGETVGSVFLQVLLLLICEGLSQDNADDEHDKSLHD 16 L F H L + G+T F ++ ++ EG + DN+DDE +SL D Sbjct: 42 LAFSHSLCLKTTYGKTDRRKFSRICSIVDDEG-NLDNSDDEEKESLDD 88 >At5g17240.1 68418.m02020 SET domain-containing protein contains Pfam profile PF00856: SET domain Length = 491 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +1 Query: 190 LKKYALCMLI-KSQLMTKDGKFKKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 366 LKK L + + + LMT + KD+ L+ N + L +++ CL + + ++ W Sbjct: 57 LKKGELVLKVPRKALMTTESIIAKDLKLSDAVNLHNSLSSTQILSVCLLYEMSKEKKSFW 116 Query: 367 NYVKCYH 387 Y +H Sbjct: 117 -YPYLFH 122 >At4g02710.1 68417.m00366 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1111 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -2 Query: 430 DYVFTRKERASGLSRGSISHNSRLFGEGCCL 338 DYVFT +E A +S+G+ + L EG CL Sbjct: 781 DYVFTHRESAGEVSKGADLMDEFLKLEGMCL 811 >At3g20860.1 68416.m02637 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 427 Score = 28.7 bits (61), Expect = 3.3 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +1 Query: 43 VCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 222 VC+V + + + +KK R SE K +V L D+ N L + C I Sbjct: 87 VCIVTSYCEGGDMTQMIKKSRGVFASEEKLCRWMVQLLLAIDYLHNNRVLHRDLKCSNI- 145 Query: 223 SQLMTKDGKFK-KDVALAKVPNAED 294 +TK+ + + D LAK+ +D Sbjct: 146 --FLTKENEVRLGDFGLAKLLGKDD 168 >At5g64710.2 68418.m08135 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 716 Score = 28.3 bits (60), Expect = 4.4 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +1 Query: 49 VVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLI--- 219 VV + + K+N K + + ++ ++ V +K D K + EP+K L + Sbjct: 237 VVSVEKMCQNMKQNDKDVKEESHQLQESSQEFVQVMKLMDVKAKEEPVKANQLAITAVDD 296 Query: 220 KSQLMTKDGKFKK 258 S KDG KK Sbjct: 297 VSSFEEKDGFLKK 309 >At5g64710.1 68418.m08134 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 841 Score = 28.3 bits (60), Expect = 4.4 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +1 Query: 49 VVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLI--- 219 VV + + K+N K + + ++ ++ V +K D K + EP+K L + Sbjct: 362 VVSVEKMCQNMKQNDKDVKEESHQLQESSQEFVQVMKLMDVKAKEEPVKANQLAITAVDD 421 Query: 220 KSQLMTKDGKFKK 258 S KDG KK Sbjct: 422 VSSFEEKDGFLKK 434 >At5g31412.1 68418.m03722 hypothetical protein contains Pfam domain, PF04937: Protein of unknown function (DUF 659) Length = 433 Score = 28.3 bits (60), Expect = 4.4 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = +1 Query: 100 HRADCLSETKADEQLVNKLKT-GDFKTENEPLKKYALCMLIKSQLMTKD-GKFKKDVALA 273 H D + E + + K++T GD+K EN L +Y C+L + +D G K + LA Sbjct: 227 HTVDLMLEAISKLPKMGKMQTFGDYKGENLFLNRYESCVLEWCDVCVEDFGPLMKLLRLA 286 Query: 274 KVPN 285 N Sbjct: 287 DGEN 290 >At3g04810.2 68416.m00521 protein kinase, putative similar to LSTK-1-like kinase [Lycopersicon esculentum] GI:15637110; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 578 Score = 28.3 bits (60), Expect = 4.4 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +1 Query: 43 VCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 222 VC+++ + E +KK +E K + LV L ++ N L + C I Sbjct: 77 VCIIIGYCKGGDMAEAIKKTNGVHFTEEKLCKWLVQILLALEYLHANHILHRDVKCSNI- 135 Query: 223 SQLMTKDGKFK-KDVALAKVPNAED 294 +TKD + D LAKV ++D Sbjct: 136 --FLTKDQDIRLGDFGLAKVLTSDD 158 >At3g04810.1 68416.m00520 protein kinase, putative similar to LSTK-1-like kinase [Lycopersicon esculentum] GI:15637110; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 606 Score = 28.3 bits (60), Expect = 4.4 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +1 Query: 43 VCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 222 VC+++ + E +KK +E K + LV L ++ N L + C I Sbjct: 77 VCIIIGYCKGGDMAEAIKKTNGVHFTEEKLCKWLVQILLALEYLHANHILHRDVKCSNI- 135 Query: 223 SQLMTKDGKFK-KDVALAKVPNAED 294 +TKD + D LAKV ++D Sbjct: 136 --FLTKDQDIRLGDFGLAKVLTSDD 158 >At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-containing protein similar to AX110P [Daucus carota] GI:285739; contains Pfam profile PF01408: Oxidoreductase family NAD-binding Rossmann fold Length = 364 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 253 KKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 366 KK L + P A+D ++EK+++AC N T W Sbjct: 95 KKKHVLVEKPPAQDATELEKIVEACEYNGVQFMDGTIW 132 >At5g28290.1 68418.m03434 protein kinase, putative similar to LSTK-1-like kinase [Lycopersicon esculentum] GI:15637110; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 568 Score = 27.9 bits (59), Expect = 5.8 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +1 Query: 43 VCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 222 VC+V+ + E +KK SE K + LV L ++ + L + C I Sbjct: 77 VCIVIGYCKGGDMAEAIKKANGVEFSEEKLCKWLVQLLMALEYLHASHILHRDVKCSNI- 135 Query: 223 SQLMTKDGKFK-KDVALAKVPNAED 294 +TKD + D LAK+ ++D Sbjct: 136 --FLTKDQDIRLGDFGLAKILTSDD 158 >At2g26780.1 68415.m03212 expressed protein contains Pfam profile TBP (TATA-binding protein) -interacting protein 120 (TIP120); contains TIGRFAM profile TIGR01612: reticulocyte binding protein Length = 1866 Score = 27.5 bits (58), Expect = 7.7 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +3 Query: 321 RLPGQQRQQPSPNSLELCEMLPRERPE 401 R P ++R++ +PN+LE LP++ E Sbjct: 114 RAPAKEREEIAPNTLENVSKLPKQHQE 140 >At2g04230.1 68415.m00410 F-box family protein contains F-box domain Pfam:PF00646 Length = 448 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 283 NAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHE 390 ++ KL++ KL D L + +P + WN KC E Sbjct: 333 DSSPKLQILKLTDVYLHDNKTNPDERKWNPPKCAPE 368 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,247,209 Number of Sequences: 28952 Number of extensions: 274869 Number of successful extensions: 766 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -