BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0111 (716 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39621| Best HMM Match : Extensin_2 (HMM E-Value=0.078) 58 7e-09 SB_112| Best HMM Match : DUF1059 (HMM E-Value=7.3) 56 2e-08 SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_23402| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_11240| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_11942| Best HMM Match : Ank (HMM E-Value=3.6e-22) 33 0.31 SB_8371| Best HMM Match : Vicilin_N (HMM E-Value=0.11) 33 0.31 SB_55376| Best HMM Match : Polyoma_agno (HMM E-Value=6.2) 32 0.53 SB_6137| Best HMM Match : NACHT (HMM E-Value=0.00017) 32 0.53 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 31 0.71 SB_12185| Best HMM Match : AAA_5 (HMM E-Value=0.002) 31 0.71 SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) 31 0.93 SB_16428| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_26185| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_53200| Best HMM Match : Apolipoprotein (HMM E-Value=0.0069) 30 1.6 SB_41173| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.8) 30 1.6 SB_14519| Best HMM Match : Ank (HMM E-Value=1.9e-17) 30 1.6 SB_54140| Best HMM Match : TFA (HMM E-Value=4.6) 29 2.8 SB_47001| Best HMM Match : Asparaginase_2 (HMM E-Value=2.5e-40) 29 2.8 SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_56838| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_6203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_46753| Best HMM Match : Fimbrial_CS1 (HMM E-Value=1.1) 29 3.8 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 29 3.8 SB_45538| Best HMM Match : HC2 (HMM E-Value=0.55) 29 5.0 SB_42464| Best HMM Match : Pro_isomerase (HMM E-Value=3.9e-06) 29 5.0 SB_21264| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) 29 5.0 SB_26241| Best HMM Match : B1 (HMM E-Value=2.5) 28 6.6 SB_13308| Best HMM Match : MFS_1 (HMM E-Value=0.0008) 28 6.6 SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) 28 6.6 SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_36361| Best HMM Match : ITAM (HMM E-Value=3.5) 28 8.7 SB_35288| Best HMM Match : ITAM (HMM E-Value=3.5) 28 8.7 SB_37613| Best HMM Match : zf-B_box (HMM E-Value=2.7e-07) 28 8.7 SB_15448| Best HMM Match : Utp11 (HMM E-Value=0.89) 28 8.7 >SB_39621| Best HMM Match : Extensin_2 (HMM E-Value=0.078) Length = 539 Score = 58.0 bits (134), Expect = 7e-09 Identities = 33/80 (41%), Positives = 47/80 (58%), Gaps = 1/80 (1%) Frame = +1 Query: 91 IPPHFNLLSSTDQFNPKADVSSGEEYPTLLHWAARFGLERVCWQ-LLECPGGGAAIAMRN 267 +P FNL+ + N + +S YPTLLH+AA FGL ++ + LLECPG A +R+ Sbjct: 1 MPRGFNLIGLHN--NNVDEEASKSMYPTLLHFAAAFGLHQLATECLLECPGAKEASTLRD 58 Query: 268 VRHRTPADLARDFKHYRLAD 327 RTP D+AR+ LA+ Sbjct: 59 CHGRTPVDIAREGDFNSLAE 78 >SB_112| Best HMM Match : DUF1059 (HMM E-Value=7.3) Length = 291 Score = 56.4 bits (130), Expect = 2e-08 Identities = 29/64 (45%), Positives = 40/64 (62%), Gaps = 1/64 (1%) Frame = +1 Query: 139 KADVSSGEEYPTLLHWAARFGLERVCWQ-LLECPGGGAAIAMRNVRHRTPADLARDFKHY 315 +A +S YPTLLH+AA FGL ++ + LLECPG A +R+ RTP D+AR+ Sbjct: 20 EAKEASKSMYPTLLHFAAAFGLHQLATECLLECPGAKEASTLRDCHGRTPVDIAREGDFN 79 Query: 316 RLAD 327 LA+ Sbjct: 80 SLAE 83 >SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 41.5 bits (93), Expect = 7e-04 Identities = 27/96 (28%), Positives = 50/96 (52%), Gaps = 1/96 (1%) Frame = +1 Query: 46 KEQLDSWMLNAFQ-KNIPPHFNLLSSTDQFNPKADVSSGEEYPTLLHWAARFGLERVCWQ 222 + LD + +AF+ ++ P + L+ + S G+E TLLH +AR G + Sbjct: 598 RNTLDYRLTSAFEFLDLSPSWTLVGENGKH---VKTSKGQE--TLLHLSARLGFTQFAEY 652 Query: 223 LLECPGGGAAIAMRNVRHRTPADLARDFKHYRLADM 330 L++ PG A+ M + + ++P D+A++ LAD+ Sbjct: 653 LVDLPGASQALGMCDTKGKSPIDVAKEKGLRSLADV 688 Score = 31.5 bits (68), Expect = 0.71 Identities = 17/66 (25%), Positives = 32/66 (48%) Frame = +1 Query: 145 DVSSGEEYPTLLHWAARFGLERVCWQLLECPGGGAAIAMRNVRHRTPADLARDFKHYRLA 324 DV+ + +L R G + L++ PG A+ M + + ++P D+A++ LA Sbjct: 675 DVAKEKGLRSLADVFLRLGFTQFAEYLVDLPGASQALGMCDTKGKSPMDVAKEKGLLSLA 734 Query: 325 DMLSDH 342 D+ H Sbjct: 735 DVFLRH 740 >SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 36.3 bits (80), Expect = 0.025 Identities = 22/84 (26%), Positives = 36/84 (42%) Frame = +1 Query: 172 TLLHWAARFGLERVCWQLLECPGGGAAIAMRNVRHRTPADLARDFKHYRLADMLSDHMKI 351 T L WA G + W+LL G + + R R P +ARD +Y + D + ++ Sbjct: 839 TALMWACGLGHKDAVWELL-LTGDICTLTTPDARGRMPLQIARDRGYYEVVDCIEEYYAS 897 Query: 352 SEFSNMYYYLKNMSDNEKQDKTEE 423 S S + +++ D EE Sbjct: 898 SP-SRQTALFNGLRSDDEDDIAEE 920 >SB_23402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.5 bits (78), Expect = 0.043 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 1 ALEFMCQTLGFKTTSKEQLDSWMLNAFQKNIPPHFNLL 114 A+ FMC++LG + LD + F++N+P FNL+ Sbjct: 95 AVSFMCESLGISPLDIQHLDEALAATFRRNMPRGFNLI 132 >SB_11240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 59 Score = 35.5 bits (78), Expect = 0.043 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 1 ALEFMCQTLGFKTTSKEQLDSWMLNAFQKNIPPHFNLL 114 A+ FMC++LG + LD + F++N+P FNL+ Sbjct: 12 AVSFMCESLGISPLDIQHLDEALAATFRRNMPRGFNLI 49 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 33.5 bits (73), Expect = 0.18 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 3/75 (4%) Frame = +1 Query: 361 SNMYYYLKNMSDNEKQ---DKTEELESKEEDLRIIETCDTVDSPICEDPEQDVIVSPPDP 531 ++ Y + N+ D EK+ DK EE++SK+EDL E + + + ++ + S D Sbjct: 184 THKYDFTSNIIDREKELIKDKIEEVKSKQEDLS-QEHANVLSEKARIEAQRKSLTSEIDE 242 Query: 532 FSETCTQNLEEISDN 576 F + LEE+ N Sbjct: 243 FIDAKVSLLEEMRSN 257 >SB_11942| Best HMM Match : Ank (HMM E-Value=3.6e-22) Length = 540 Score = 32.7 bits (71), Expect = 0.31 Identities = 34/92 (36%), Positives = 45/92 (48%) Frame = +1 Query: 172 TLLHWAARFGLERVCWQLLECPGGGAAIAMRNVRHRTPADLARDFKHYRLADMLSDHMKI 351 T +H AA G + C QLL GG I + H TP DLAR + H A +LS+H Sbjct: 322 TPVHRAAIEGHVK-CLQLLIRAGGD--IEREDNEHNTPMDLARVWGHRPCARILSNHQ-- 376 Query: 352 SEFSNMYYYLKNMSDNEKQDKTEELESKEEDL 447 +YL + E+ K EE E KE++L Sbjct: 377 -------WYLD--KEKERIKKLEE-EIKEQEL 398 >SB_8371| Best HMM Match : Vicilin_N (HMM E-Value=0.11) Length = 323 Score = 32.7 bits (71), Expect = 0.31 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 1/92 (1%) Frame = +1 Query: 406 QDKTEELESKEEDLRIIETCDTVDSPICEDPEQDVIVSPPDPFSETCTQNLEEISDNSDE 585 Q+ EE E + +R ++ D D+ +D + D D +TC +EE+++N + Sbjct: 158 QNIKEENEKLNDTIRKLQ--DNCDNDDDDDDDDD---DDADYDDKTCEAKMEEVTNNLRQ 212 Query: 586 S-EKQSRASFKLPKVKEQQLYQNELPCHDDTA 678 S E+Q + S KV+ QQ EL C D A Sbjct: 213 STEEQHQLSH---KVQRQQQRIEELTCELDLA 241 >SB_55376| Best HMM Match : Polyoma_agno (HMM E-Value=6.2) Length = 346 Score = 31.9 bits (69), Expect = 0.53 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Frame = +1 Query: 466 DTVDSPICEDPEQDVIVSPPDPFSETCTQNL----EEISDNSDESEKQSRASFKLPKVKE 633 D + +C P+ + I PP P + ++NL +E SD+++ Q RA ++ K +E Sbjct: 204 DKDEDKVCGTPQNNAIHRPPPPGNPVSSENLPEYCKEFSDSTNLRALQ-RAEDRIRKRRE 262 Query: 634 QQLYQNE 654 Q Y E Sbjct: 263 AQEYTTE 269 >SB_6137| Best HMM Match : NACHT (HMM E-Value=0.00017) Length = 1243 Score = 31.9 bits (69), Expect = 0.53 Identities = 43/157 (27%), Positives = 69/157 (43%), Gaps = 10/157 (6%) Frame = +1 Query: 271 RHRTPADLARDFKHYRLADMLSDHMK-ISEFSNMYYYL--KNMSDNEKQDKTEELESKEE 441 R D A F+ ++ AD+ D ++ I + N+ K + D+EK +S++ Sbjct: 178 RRSGATDYAALFEEWKKADV--DLLREIRDVGNVVVQSVSKEIQDSEKSISKVIQDSEKS 235 Query: 442 DLRIIETCDTVDSPICEDPEQDVIVSPPDPFSETCTQNLEEISDNS-DESE-----KQSR 603 ++I+ + S D EQ V E C Q L+++++ DE+E KQ + Sbjct: 236 ISKVIQDSEKSISKEIRDLEQSVREEVIRSIHEVC-QKLDDVTNKDLDEAERVEFAKQEK 294 Query: 604 ASFKLPKVKEQQLYQ-NELPCHDDTADRIQQAIENDY 711 S L VK L Q +L D D I+QAI Y Sbjct: 295 DSSFLEDVKVVLLLQCRDLVDVSDWKDVIRQAIPEHY 331 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 31.5 bits (68), Expect = 0.71 Identities = 26/111 (23%), Positives = 53/111 (47%), Gaps = 3/111 (2%) Frame = +1 Query: 379 LKNMSDNEKQDKTE-ELESKEEDLRIIETCDTVDSPICEDPEQDVIVSPPDPFSETCTQN 555 + N ++EK+++ + +L E + +E ++S I E V S D ++ Q+ Sbjct: 1569 INNRINSEKENELQSKLSQAHEQIINLENRPQLESAISMVSESMVESSGDDMETQILRQD 1628 Query: 556 LEEISDNSDESEKQSRASFKLPKVKEQQLYQNE--LPCHDDTADRIQQAIE 702 LE + D+ E+Q++ +QQL + + L ++D +Q+ IE Sbjct: 1629 LETLQSKYDKLERQNKLLQDQNSQLQQQLNERDRKLRDNEDEIMELQKVIE 1679 >SB_12185| Best HMM Match : AAA_5 (HMM E-Value=0.002) Length = 3616 Score = 31.5 bits (68), Expect = 0.71 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 476 TRLSAKIQNKMS*CLPRIPSAKRARKIWKKF 568 + L A++QN M C +IPS +RA ++ +KF Sbjct: 561 SELQAQLQNFMDICFEKIPSTQRALRLIRKF 591 >SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) Length = 1292 Score = 31.1 bits (67), Expect = 0.93 Identities = 27/122 (22%), Positives = 54/122 (44%) Frame = +1 Query: 337 DHMKISEFSNMYYYLKNMSDNEKQDKTEELESKEEDLRIIETCDTVDSPICEDPEQDVIV 516 D ++ SE S+ + LKN + K + L+S+ ++ TC+ + I E EQ+ + Sbjct: 1170 DEVEASEPSDAFESLKNQLERYKNIENLLLQSEAKNAETERTCEARITGIKEAYEQE-LE 1228 Query: 517 SPPDPFSETCTQNLEEISDNSDESEKQSRASFKLPKVKEQQLYQNELPCHDDTADRIQQA 696 + E T ++I S + E++ KL + ++ + Q E + R++ Sbjct: 1229 NASASHKEALTALNQKIKQLSSDKEEKMIQIGKLKRQVQELMEQQESGAEMNVDSRLEMI 1288 Query: 697 IE 702 E Sbjct: 1289 RE 1290 >SB_16428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1005 Score = 30.7 bits (66), Expect = 1.2 Identities = 23/100 (23%), Positives = 44/100 (44%) Frame = +1 Query: 388 MSDNEKQDKTEELESKEEDLRIIETCDTVDSPICEDPEQDVIVSPPDPFSETCTQNLEEI 567 +S E DK ++ + + E T D+P + P QD++ + P P ++ + +E+ Sbjct: 484 VSQKENGDKNNNIKEEGANTPDNEKSAT-DTPSDDKPHQDLVPTSPPP-AKPLSDRVEKW 541 Query: 568 SDNSDESEKQSRASFKLPKVKEQQLYQNELPCHDDTADRI 687 S+ Q R+S +L E + L +A+ I Sbjct: 542 ERISNHGLDQERSSMRLSSELEDDAFLPSLSDRRQSAEDI 581 >SB_26185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 30.7 bits (66), Expect = 1.2 Identities = 34/133 (25%), Positives = 62/133 (46%), Gaps = 1/133 (0%) Frame = +1 Query: 295 ARDFKHYRLADMLSDHMKISEFSNMYYYLKNMSDNEKQDKTEELESKEED-LRIIETCDT 471 AR+ KH L + L D+ + + YY + + ++D+ E+ES E D R +E + Sbjct: 362 ARERKH--LLEFLEDYDDNRD--DPKYYKSSSMNRRRRDREAEMESDERDRQRELEEIEE 417 Query: 472 VDSPICEDPEQDVIVSPPDPFSETCTQNLEEISDNSDESEKQSRASFKLPKVKEQQLYQN 651 + + + P +D +P ++S S+ E+ S FK PK+ Q +Q Sbjct: 418 IRKRLVDMPAED----DNEPM---------QVSRESEREEEDSSDGFK-PKL--QPTFQ- 460 Query: 652 ELPCHDDTADRIQ 690 P H +TA +++ Sbjct: 461 PAPAHIETAPKVR 473 >SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 30.3 bits (65), Expect = 1.6 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 2/88 (2%) Frame = +1 Query: 382 KNMSDNEKQDKTEELESKEEDLRIIETCDTVDSPICEDPEQDVIVSPPDPFSETCTQN-- 555 K+M++ EK +ELE +E+DL E + E +IV + + Q Sbjct: 348 KDMAEEEKNAVAKELEKREKDLMEAEEEQNKLQERLKAVESKIIVGGVNLLEKAKEQELL 407 Query: 556 LEEISDNSDESEKQSRASFKLPKVKEQQ 639 LEE + E ++ KL K KEQ+ Sbjct: 408 LEESAKELAERRERQENLQKLIKEKEQE 435 >SB_53200| Best HMM Match : Apolipoprotein (HMM E-Value=0.0069) Length = 246 Score = 30.3 bits (65), Expect = 1.6 Identities = 24/108 (22%), Positives = 49/108 (45%), Gaps = 5/108 (4%) Frame = +1 Query: 394 DNEKQDKTEELESKEEDLRIIETCDTVDSPI-----CEDPEQDVIVSPPDPFSETCTQNL 558 D + E LE+ +E L E+ +T+D P+ D + + PD ET ++L Sbjct: 30 DESLETLDESLETLDESLD--ESLETLDEPLETLDESLDESLETLDESPDESLETLDESL 87 Query: 559 EEISDNSDESEKQSRASFKLPKVKEQQLYQNELPCHDDTADRIQQAIE 702 +E + DES + S + + ++L ++ D++ D + ++ Sbjct: 88 DESLETLDESLETLHESLETLQESLEKLLESLHESLDESLDESLETLD 135 >SB_41173| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.8) Length = 405 Score = 30.3 bits (65), Expect = 1.6 Identities = 22/91 (24%), Positives = 45/91 (49%), Gaps = 2/91 (2%) Frame = +1 Query: 391 SDNEKQDKTEELESKEEDLRIIETCDTVDSPICEDPEQDVIVSPPDPFSETCTQNLEEIS 570 +D++K + E + +D + E +SP +D E+ P P ET + + Sbjct: 268 ADDKKSTEPAEPVEQSQDSGVAEA----ESPAEQDSEEGTPGMSP-PVDETDGNKVHRST 322 Query: 571 DN-SDESEKQSRASFKLPKVKEQQL-YQNEL 657 + SD+ K+ + ++ ++KEQ+L YQ ++ Sbjct: 323 SSISDDGHKKRKLQLEIDRLKEQELEYQKKI 353 >SB_14519| Best HMM Match : Ank (HMM E-Value=1.9e-17) Length = 169 Score = 30.3 bits (65), Expect = 1.6 Identities = 22/57 (38%), Positives = 26/57 (45%) Frame = +1 Query: 172 TLLHWAARFGLERVCWQLLECPGGGAAIAMRNVRHRTPADLARDFKHYRLADMLSDH 342 T LHWAA G R LLE GA + V TPA A + Y + +L DH Sbjct: 48 TALHWAAGKGHARCVKLLLEY---GANPGAKMVGGWTPAHCAAETGRYNVLKVLVDH 101 >SB_54140| Best HMM Match : TFA (HMM E-Value=4.6) Length = 337 Score = 29.5 bits (63), Expect = 2.8 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = +1 Query: 517 SPPDPFSETCTQNLEEISDNSDESEKQSRASFKLPKVKEQQLYQNELPCHDD 672 S DP E T ++ SDN+DES+K +P + Q ++EL C D Sbjct: 104 SSSDPRLENTTSTRQQQSDNADESKKTCAEQRVVPMTEVQ---EHELLCRLD 152 >SB_47001| Best HMM Match : Asparaginase_2 (HMM E-Value=2.5e-40) Length = 423 Score = 29.5 bits (63), Expect = 2.8 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = +1 Query: 379 LKNMSDNEKQDKTE-ELESKEEDLRIIETCDTVDSPICEDPEQDVIVSPPDPFSETCTQN 555 +K M + E +K + E E KEED + + ++ ++ + PE+ V D E + Sbjct: 211 VKKMEEKENNEKLQKEKEDKEEDKKDFDCVNSFETELQSKPEKREEVKEQD--IELVLKM 268 Query: 556 LEEISDNSDESE 591 +EEI N DE + Sbjct: 269 IEEIK-NIDEHD 279 >SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 29.5 bits (63), Expect = 2.8 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 4/107 (3%) Frame = +1 Query: 400 EKQDKTEELESK-EEDLRIIETCDTVDSPICED-PEQDVIVSPPDPFSETCTQNLEEISD 573 EK+ T +LES E+ + I + +V + +DV+ S +E C QN EISD Sbjct: 581 EKRAITTDLESSIEKRVSIEKELQSVKEQLETGYRSRDVVESELAVATERCRQNAAEISD 640 Query: 574 NSDE--SEKQSRASFKLPKVKEQQLYQNELPCHDDTADRIQQAIEND 708 E S + +F+ K ++ Q D D + ++E + Sbjct: 641 QQHEILSLNEENTAFQQQLEKREKHIQELSESLDSLQDSLATSLEKN 687 >SB_56838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 29.1 bits (62), Expect = 3.8 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 172 TLLHWAARFGLERVCWQLLECPGGGAAIAMRNVRHRTPADLARDFKH 312 T LHWA V + + GA+I + N + TPAD+A + K+ Sbjct: 110 TALHWAVSSNNHNVIHPIAKA---GASIDLVNAKGETPADIATEKKN 153 >SB_6203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 741 Score = 29.1 bits (62), Expect = 3.8 Identities = 18/53 (33%), Positives = 28/53 (52%) Frame = +1 Query: 145 DVSSGEEYPTLLHWAARFGLERVCWQLLECPGGGAAIAMRNVRHRTPADLARD 303 ++ G T LH AA+ G ++ LL+ GGA + +RNV + D+A D Sbjct: 67 NIQDGLGKSTALHLAAKNGHLKIIQVLLD---GGAKLNLRNVEGKIAEDVALD 116 >SB_46753| Best HMM Match : Fimbrial_CS1 (HMM E-Value=1.1) Length = 982 Score = 29.1 bits (62), Expect = 3.8 Identities = 26/94 (27%), Positives = 43/94 (45%) Frame = +1 Query: 394 DNEKQDKTEELESKEEDLRIIETCDTVDSPICEDPEQDVIVSPPDPFSETCTQNLEEISD 573 D EKQ + +E K ++ + E + P + +QD PD E Q+ E+ Sbjct: 851 DLEKQYQKQEKPDKGQEKQDREQ----EKPDKDQEKQDREQEKPDKDQEK--QDHEQEKP 904 Query: 574 NSDESEKQSRASFKLPKVKEQQLYQNELPCHDDT 675 + D+ EKQ R K K +EQ + + P ++T Sbjct: 905 DKDQ-EKQDREQEKTDKEREQPYQEQDKPDQENT 937 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 29.1 bits (62), Expect = 3.8 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = +1 Query: 178 LHWAARFGLERVCWQLLECPGGGAAIAMRNVRHRTPADLARDFKHYRLADMLSDH 342 LH AA G L+E GA + R TP DLA + H +ADM+ ++ Sbjct: 34 LHEAAARGYTDCFQALVEM---GAPLHPRTTEGDTPRDLALRYGHVHIADMIDNY 85 >SB_45538| Best HMM Match : HC2 (HMM E-Value=0.55) Length = 333 Score = 28.7 bits (61), Expect = 5.0 Identities = 19/87 (21%), Positives = 36/87 (41%), Gaps = 2/87 (2%) Frame = +1 Query: 337 DHMKISEFSNMYYYLKNMSDNEKQDKTEELESK--EEDLRIIETCDTVDSPICEDPEQDV 510 DH + F+ Y + + +SK + LR TC+ + + ED Q Sbjct: 197 DHTQSKVFAKRLRYRTTCNQMYHTVSEDHTQSKVVAKRLRYRTTCNQMYHTVSEDHTQSK 256 Query: 511 IVSPPDPFSETCTQNLEEISDNSDESE 591 +V+ + TC Q +S++ +S+ Sbjct: 257 VVAKRLRYRTTCNQMYHTVSEDHTQSK 283 >SB_42464| Best HMM Match : Pro_isomerase (HMM E-Value=3.9e-06) Length = 454 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/73 (20%), Positives = 35/73 (47%) Frame = +1 Query: 400 EKQDKTEELESKEEDLRIIETCDTVDSPICEDPEQDVIVSPPDPFSETCTQNLEEISDNS 579 E +D EE+++ + +++ + D +D P+ S P +E +N D+S Sbjct: 139 EAEDDEEEVKTVSKKMKMASSHDILDDPLLSKEAAVPQESQPVKETERNRKNSSSGDDDS 198 Query: 580 DESEKQSRASFKL 618 D+ +++ + K+ Sbjct: 199 DDEKQEEKFDQKM 211 >SB_21264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 28.7 bits (61), Expect = 5.0 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 2/94 (2%) Frame = +1 Query: 385 NMSDNEKQDKTEELESKEEDLRIIETCDTVDSPICED-PEQDVIVSPPDPFSETCTQNLE 561 + D E+QDK EE+E K+++ + + +D ED +QD E Q+ E Sbjct: 63 DQEDMEEQDK-EEMEQKDKEDMDEQDKEDMDKQDKEDMDKQDKEEMDKQDKEEMDKQDKE 121 Query: 562 EISDNSDESEKQSRASFKLPKV-KEQQLYQNELP 660 E+ D D+ E + ++ K KE+ Q+ +P Sbjct: 122 EM-DKQDKEEMDKQDKEEMDKQDKEEMDQQDRIP 154 >SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) Length = 843 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +3 Query: 588 RKAISCVVQTSKSQRTTTVPKRIAVSRRHSGQD 686 +K + C V T KS ++ T P+R AVSR + ++ Sbjct: 193 KKRLVCHVPTEKSGKSITCPQRKAVSRSRAHRE 225 >SB_26241| Best HMM Match : B1 (HMM E-Value=2.5) Length = 155 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +3 Query: 624 SQRTTTVPKRIAVSRRHSGQD 686 S RTTT K IAVSRR++ +D Sbjct: 54 SGRTTTSAKHIAVSRRYNSKD 74 >SB_13308| Best HMM Match : MFS_1 (HMM E-Value=0.0008) Length = 700 Score = 28.3 bits (60), Expect = 6.6 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = -3 Query: 612 ERRTRLLFGFIRVIRNFFQILRARFAEGIRGRHYDILFWIFAD 484 E + L+ I + F ++ + FA G+ HY +FW D Sbjct: 473 EGADKTLYDVIFTFKTFTILVLSFFAGGLSAVHYTFIFWYLTD 515 >SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) Length = 1366 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 484 ICEDPEQDVIVSPPDPFSETCTQNLEEISDNSDESE 591 I + ++D +SP +P T EEI N DESE Sbjct: 242 IINNTKEDTFISPRNPPENTSKAFPEEIKRNIDESE 277 >SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 28.3 bits (60), Expect = 6.6 Identities = 20/71 (28%), Positives = 33/71 (46%) Frame = +1 Query: 385 NMSDNEKQDKTEELESKEEDLRIIETCDTVDSPICEDPEQDVIVSPPDPFSETCTQNLEE 564 N DNE+ ++ EE KEE+ +E + + E+ E ++ V + E EE Sbjct: 27 NREDNEQDEEEEEEVEKEEEEEEVEEEEEEE----EEKEDEIEVEEEEEEKE---NEEEE 79 Query: 565 ISDNSDESEKQ 597 D DE E++ Sbjct: 80 NEDEEDEEEEE 90 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 28.3 bits (60), Expect = 6.6 Identities = 27/128 (21%), Positives = 53/128 (41%), Gaps = 2/128 (1%) Frame = +1 Query: 289 DLARDFKHYRLADMLSDHMKISEFSNMYYYLKNMSDNEKQDKTEELESKEEDLRIIETCD 468 +LA +H +AD+ H + + + + ++K++ E+E + L E Sbjct: 670 ELASTKRH--IADLQDKHEALKDELDKTEDENDALRDKKKELEAEIEELKRKLAESELNI 727 Query: 469 TVDSPICEDPEQDVIVSPPD-PFSETC-TQNLEEISDNSDESEKQSRASFKLPKVKEQQL 642 + PI E ++ S PD F ++ + L+E + + + A KL K + L Sbjct: 728 PIQQPIVEAQNVQIVQSSPDFDFGDSDELRRLQEDNISLRHKNSELEAESKLADDKRKDL 787 Query: 643 YQNELPCH 666 + CH Sbjct: 788 NDQLVGCH 795 >SB_36361| Best HMM Match : ITAM (HMM E-Value=3.5) Length = 208 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +1 Query: 562 EISDNSDESEKQSRASFKLPKVKEQQLYQNELPCHDDTADRIQQAIEN 705 + ++ + E + ++F P+ K+ Y+N H DTAD Q +N Sbjct: 131 DTANGNYEQIQAKNSTFASPQAKDNAAYENINGDHYDTADATQAQYDN 178 >SB_35288| Best HMM Match : ITAM (HMM E-Value=3.5) Length = 145 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +1 Query: 562 EISDNSDESEKQSRASFKLPKVKEQQLYQNELPCHDDTADRIQQAIEN 705 + ++ + E + ++F P+ K+ Y+N H DTAD Q +N Sbjct: 68 DTANGNYEQIQAKNSTFASPQAKDNAAYENINGDHYDTADATQAQYDN 115 >SB_37613| Best HMM Match : zf-B_box (HMM E-Value=2.7e-07) Length = 533 Score = 27.9 bits (59), Expect = 8.7 Identities = 23/104 (22%), Positives = 46/104 (44%), Gaps = 3/104 (2%) Frame = +1 Query: 370 YYYLKNMSDNEKQD---KTEELESKEEDLRIIETCDTVDSPICEDPEQDVIVSPPDPFSE 540 +Y+ N+ D EK + K EE++SK+ D + V+ + +++ + S D F Sbjct: 113 FYFTSNIIDREKDEIKAKLEEVKSKQTDSSQLHD-KVVNEKARIEAQKNSLTSEIDDFIN 171 Query: 541 TCTQNLEEISDNSDESEKQSRASFKLPKVKEQQLYQNELPCHDD 672 LE++ R++ K + + + +L CH+D Sbjct: 172 AQISTLEKM-----------RSNLKDEVISDYEKRNKQLDCHED 204 >SB_15448| Best HMM Match : Utp11 (HMM E-Value=0.89) Length = 1328 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +1 Query: 310 HYRLADMLSDHMKISEFSNMYYYLKNMSDNEKQDKTEELESKEEDLRIIET 462 H+R+ ++ +H KI + + Y +N ++ EELES + L +T Sbjct: 608 HFRMPEVFEEHKKIVNANRVQY--ENSLKMRRERFVEELESYSKQLEEFQT 656 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.131 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,904,688 Number of Sequences: 59808 Number of extensions: 460826 Number of successful extensions: 1715 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 1564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1706 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -