BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0108 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC110.01 |ppk1|SPAC140.05|serine/threonine protein kinase Ppk1... 29 0.77 SPAC31G5.09c |spk1||MAP kinase Spk1|Schizosaccharomyces pombe|ch... 25 9.5 SPCC645.09 |mrpl37||mitochondrial ribosomal protein subunit L37|... 25 9.5 >SPAC110.01 |ppk1|SPAC140.05|serine/threonine protein kinase Ppk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1023 Score = 28.7 bits (61), Expect = 0.77 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = -2 Query: 610 KKSVTNASLTSLTSNLFFISEFNYTTSSSLQRL---STKN 500 K+S+ A+LTS ++ FF+SE TS L R STKN Sbjct: 447 KESLPYANLTSASNTHFFLSENQNDTSERLTRTLRKSTKN 486 >SPAC31G5.09c |spk1||MAP kinase Spk1|Schizosaccharomyces pombe|chr 1|||Manual Length = 372 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 305 INLCDILPPPPYESPEN 355 I++ DILPPP Y+ E+ Sbjct: 98 ISILDILPPPSYQELED 114 >SPCC645.09 |mrpl37||mitochondrial ribosomal protein subunit L37|Schizosaccharomyces pombe|chr 3|||Manual Length = 139 Score = 25.0 bits (52), Expect = 9.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 176 VCPAADLDYDYPQWHW 223 V P A D++YP+W W Sbjct: 93 VDPVAREDHEYPEWLW 108 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,211,038 Number of Sequences: 5004 Number of extensions: 41553 Number of successful extensions: 128 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -