BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0097 (720 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0105 - 823302-823770,823902-824006,824149-824540 29 3.7 11_01_0105 - 786623-787091,787229-787333,787476-787864 29 3.7 02_05_1052 + 33770355-33773981,33774217-33774336,33774880-337749... 29 3.7 08_01_0603 + 5308333-5308659,5309688-5309813,5309896-5311470 28 8.6 >12_01_0105 - 823302-823770,823902-824006,824149-824540 Length = 321 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 310 KHPTKFYNTNYRQKSSCFGTK 248 KHP +Y YRQ+ C TK Sbjct: 163 KHPRSYYRCTYRQEEKCKATK 183 >11_01_0105 - 786623-787091,787229-787333,787476-787864 Length = 320 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 310 KHPTKFYNTNYRQKSSCFGTK 248 KHP +Y YRQ+ C TK Sbjct: 162 KHPRSYYRCTYRQEEKCKATK 182 >02_05_1052 + 33770355-33773981,33774217-33774336,33774880-33774996, 33775322-33775411,33775971-33776078,33776304-33776351 Length = 1369 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -1 Query: 315 SLSTLQNSTIQTTDKSRRASAPRDVET 235 S+S++ N+T QTT KS R +PR T Sbjct: 362 SVSSMSNATSQTTAKSTRGLSPRRTST 388 >08_01_0603 + 5308333-5308659,5309688-5309813,5309896-5311470 Length = 675 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -3 Query: 403 TWRTPMWNKENKTLRFNSKNSSKTPKYRIFIKHPTKFYNTNYRQKSSCFG 254 T T +K N + S+N +P IF+++PTK Y+ S G Sbjct: 448 TRETEPCHKHNSPVH-ESENQQDSPMTDIFLENPTKLYSNRSHYNESDMG 496 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,460,784 Number of Sequences: 37544 Number of extensions: 276165 Number of successful extensions: 429 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -