BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0097 (720 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56667| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) 29 5.0 SB_55120| Best HMM Match : DUF854 (HMM E-Value=8.5) 28 8.8 >SB_56667| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) Length = 628 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -2 Query: 692 NY*IPFQGGDISNMSTR*NCNVIQYN--FHTNKQTSVREKYHLLI 564 NY + ++ ++N TR NV+ YN F N TS+ ++ LI Sbjct: 382 NYTLRYEPNTVTNRKTRKRNNVLWYNPPFSKNTSTSIGHRFLTLI 426 >SB_55120| Best HMM Match : DUF854 (HMM E-Value=8.5) Length = 327 Score = 27.9 bits (59), Expect = 8.8 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -1 Query: 366 P*DLIVKIHRKHQNIGFSLSTLQNSTIQTTDKSRR 262 P D +I++ QN+G+S ++L N +T K R+ Sbjct: 56 PADCRPEINQSAQNVGYSTASLYNPNSTSTSKERK 90 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,470,860 Number of Sequences: 59808 Number of extensions: 369308 Number of successful extensions: 654 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -