BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0094 (792 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 24 1.9 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 24 1.9 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 21 9.9 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 9.9 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.8 bits (49), Expect = 1.9 Identities = 15/61 (24%), Positives = 25/61 (40%) Frame = +3 Query: 600 TYHKNSYASLDPVQAKQLFREVRGLPKYDPYLSIVQISIGGRDKTDFW*IFSNIINVTRC 779 +Y+ Y S+D + K L + KY S ++I F+ I+ II+ Sbjct: 372 SYNTEFYGSIDTLARKILGYNLEAASKYQIVPSALEIFSTSMKDPAFYRIYKRIIDYYHS 431 Query: 780 Y 782 Y Sbjct: 432 Y 432 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.8 bits (49), Expect = 1.9 Identities = 15/61 (24%), Positives = 25/61 (40%) Frame = +3 Query: 600 TYHKNSYASLDPVQAKQLFREVRGLPKYDPYLSIVQISIGGRDKTDFW*IFSNIINVTRC 779 +Y+ Y S+D + K L + KY S ++I F+ I+ II+ Sbjct: 372 SYNTEFYGSIDTLARKILGYNLEAASKYQIVPSALEIFSTSMKDPAFYRIYKRIIDYYHS 431 Query: 780 Y 782 Y Sbjct: 432 Y 432 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +1 Query: 355 KRPKTKRSQ 381 KRPKTK+SQ Sbjct: 39 KRPKTKKSQ 47 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 9.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 112 LSATLLEGTFSSDVDNVVT 56 L A L+G F SD++ V T Sbjct: 528 LEAIRLDGNFLSDINGVFT 546 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,899 Number of Sequences: 438 Number of extensions: 4278 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -