BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0091 (633 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 25 0.61 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 23 1.9 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 23 1.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 4.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 4.3 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 4.3 X02007-1|CAA26038.1| 70|Apis mellifera prepromelittin protein. 21 9.9 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 25.0 bits (52), Expect = 0.61 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 3/78 (3%) Frame = +2 Query: 275 WSRGDLGDSVSSERTGQRSEDSRRQRYSIYK*NGGHA*AEKLEYWCIFREGFGREHHQ-- 448 W G GD +SSE ++ S ++ I K + G + +W F + + ++ + Sbjct: 187 WGEGSSGDDLSSEWDSDYTDKSNEKK--IPK-SSGWRKLRNIVHWTPFFQTYKKQRYPWV 243 Query: 449 GFPGNAGS-TAGDRPGEI 499 G+ G+ AG PG I Sbjct: 244 QLAGHQGNFRAGPTPGTI 261 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 455 PGNAGSTAGDRPGEIRRGHHGNVL 526 PGN + + PG G H N+L Sbjct: 60 PGNFSPSGPNSPGSFTAGCHSNLL 83 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 455 PGNAGSTAGDRPGEIRRGHHGNVL 526 PGN + + PG G H N+L Sbjct: 60 PGNFSPSGPNSPGSFTAGCHSNLL 83 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 572 PGHLKYCPVTSFGIVEERFR 513 PG++ Y T+ G + E+FR Sbjct: 544 PGYMIYIWFTTSGTISEKFR 563 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 572 PGHLKYCPVTSFGIVEERFR 513 PG++ Y T+ G + E+FR Sbjct: 597 PGYMIYIWFTTSGTISEKFR 616 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.2 bits (45), Expect = 4.3 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 510 ITETFFNDAEAGYGAVLQVPWILMSTIAMMPQLE 611 +T + E+G+ L WIL S + QLE Sbjct: 779 VTLAILDFHESGFMESLDNHWILRSNVQQCEQLE 812 >X02007-1|CAA26038.1| 70|Apis mellifera prepromelittin protein. Length = 70 Score = 21.0 bits (42), Expect = 9.9 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 531 DAEAGYGAVLQV 566 D EAG GAVL+V Sbjct: 40 DPEAGIGAVLKV 51 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,604 Number of Sequences: 438 Number of extensions: 4319 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -