BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0085 (363 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 75 1e-15 DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosylt... 25 1.2 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 24 1.5 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 24 1.5 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 24 1.5 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 24 1.5 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 24 1.5 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 24 1.5 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 24 1.5 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 24 1.5 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 24 1.5 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 24 1.5 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 24 1.5 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 24 1.5 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 24 1.5 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 24 1.5 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 24 1.5 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 24 1.5 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 24 1.5 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 24 1.5 AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. 24 1.5 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 24 1.5 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 24 1.5 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 24 1.5 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 24 1.5 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 24 1.5 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 2.7 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 3.5 AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 22 6.2 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 22 6.2 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 22 6.2 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 22 6.2 AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 22 6.2 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 22 8.1 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 74.5 bits (175), Expect = 1e-15 Identities = 38/109 (34%), Positives = 63/109 (57%), Gaps = 1/109 (0%) Frame = +2 Query: 38 QLAEFQEAFQLFDSRGDGKIHVAQIGDALRALGQNPTESDVKKCT-LHLKPDERISFEVF 214 ++ + Q F ++D G G++ +G+ALRAL NPT + K + +++I FE F Sbjct: 9 EIEKAQFVFSVYDWEGSGQMDAMDLGNALRALNLNPTIELIGKMGGTQKRGEKKIKFEEF 68 Query: 215 LPIYQAISKARSGDTANDFIEGLRHFDKDGNGFISSAELRHLLSTLGEK 361 LPI+ + K + DF+E L+ +DK+ +G + AEL H L+ LGE+ Sbjct: 69 LPIFSQVKKEKEQGCFEDFLECLKLYDKNEDGTMLLAELTHSLTALGER 117 >DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosyltransferase 2 protein. Length = 451 Score = 24.6 bits (51), Expect = 1.2 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 256 VATACFRYGLVNWQKHLKRYPFIRFKMKS 170 VA+ C R N + +LKR+ +RF +S Sbjct: 347 VASDCTRMEFYNLKNYLKRFRVVRFVPES 375 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 242 FSQNLEHFDLRGNGF 256 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 269 FIEGLRHFDKDGNGF 313 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.4 bits (48), Expect = 2.7 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +3 Query: 231 PYRKHAVATLLMTLLRVCAILTKMAMGSSLLRNCDTCSL--LSERS 362 P ++ LL+ L +IL + ++NC +CS+ +S+RS Sbjct: 313 PAQQDRFNVLLLILFLCVSILGTLITPELWMKNCKSCSISPVSDRS 358 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.0 bits (47), Expect = 3.5 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -3 Query: 271 KVISSVATACFRYGLVNWQKHL-KRYP 194 K+++SV+ + RY W K L KR P Sbjct: 777 KLLASVSESVMRYAAPVWSKELQKREP 803 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +3 Query: 279 VCAILTKMAMGSSLLRNCDTCSLLSERS 362 VC ++ + + ++ CDT L+ E+S Sbjct: 5 VCIVVFALVTPNLIVAECDTKGLIVEKS 32 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 22.2 bits (45), Expect = 6.2 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 162 KNVLFILNLMKGYLLRCFCQFTRPYRKHAVATL 260 +N+ F L+ +R F F PY+ VAT+ Sbjct: 652 RNMGFPLDRRVANTVRSFQDFVAPYQNMRVATI 684 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 22.2 bits (45), Expect = 6.2 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +2 Query: 221 IYQAISKARSGDTANDFIEGLRHFDKDGNGFISSAE 328 + + + + R DTA + H DK+ F+ A+ Sbjct: 473 VEKEVRERREADTAAELRYAKEHADKENRHFLQYAQ 508 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 22.2 bits (45), Expect = 6.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 89 HLHENRRAGRLLEILP 42 H H NRR LLE +P Sbjct: 545 HNHFNRRVNILLEFIP 560 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 22.2 bits (45), Expect = 6.2 Identities = 6/11 (54%), Positives = 11/11 (100%) Frame = +1 Query: 322 CGTATPALYSR 354 CG++TPA+Y++ Sbjct: 356 CGSSTPAIYTK 366 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 21.8 bits (44), Expect = 8.1 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = +3 Query: 219 QFTRPYRKHAVATLLMTLLRVCAILTKMA 305 +F +P+ KH++A + VC ++ + A Sbjct: 955 KFRKPFYKHSIAENSQYGVAVCTVVAEDA 983 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 386,113 Number of Sequences: 2352 Number of extensions: 7692 Number of successful extensions: 56 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 27084645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -