BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0083 (415 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19670.1 68416.m02492 FF domain-containing protein / WW domai... 28 2.2 At3g18020.1 68416.m02290 pentatricopeptide (PPR) repeat-containi... 28 2.9 At2g43200.1 68415.m05369 dehydration-responsive family protein s... 27 5.0 At5g60320.1 68418.m07560 lectin protein kinase family protein co... 26 8.7 At4g17080.1 68417.m02574 MORN (Membrane Occupation and Recogniti... 26 8.7 >At3g19670.1 68416.m02492 FF domain-containing protein / WW domain-containing protein weak similarity to huntingtin-interacting protein HYPA/FBP11 [Homo sapiens] GI:3341980; contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 960 Score = 28.3 bits (60), Expect = 2.2 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 5/53 (9%) Frame = +2 Query: 152 DRYAQHRGPLHHEE--AFRYYASVYVPHGVS---GGRDQHCRWRALVPSVREN 295 DR + HH++ A +Y + PHG GRD H R R SV+EN Sbjct: 849 DRVRERDSDDHHKKGAAGKYNHDMNEPHGKERRRSGRDSHNRHRERHTSVKEN 901 >At3g18020.1 68416.m02290 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 688 Score = 27.9 bits (59), Expect = 2.9 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +1 Query: 19 YLLKLKS*WI---RVCLIIILS*PFSRSPVSTLTSLR----------PLPTNYVKMS*SI 159 +LL L S +I R C +II +SRSPVSTL + P TNY ++ + Sbjct: 113 FLLFLASGFIPDERTCNVIIARLLYSRSPVSTLGVIHRLIGFKKEFVPSLTNYNRLMNQL 172 Query: 160 CTTSRAL 180 CT R + Sbjct: 173 CTIYRVI 179 >At2g43200.1 68415.m05369 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 611 Score = 27.1 bits (57), Expect = 5.0 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -3 Query: 194 LPHDVRALDVVHIDQLIFT*LVGNGLRLVSVETGLRENGH 75 LP+ R+ D+VH + + +GL L+ V+ LR G+ Sbjct: 271 LPYPSRSFDMVHCSRCLVNWTSYDGLYLMEVDRVLRPEGY 310 >At5g60320.1 68418.m07560 lectin protein kinase family protein contains Pfam domains, PF00069: Protein kinase domain, PF00139: Legume lectins beta domain, and PF00138: Legume lectins alpha domain Length = 675 Score = 26.2 bits (55), Expect = 8.7 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +3 Query: 189 RKRSATMLVCMFLMALVVAATSIAGGVLLYRQ 284 ++ + L+ + LM LV+ ++ GG+ LYR+ Sbjct: 286 KQEQTSPLLIVLLMLLVLIMLAVLGGIYLYRR 317 >At4g17080.1 68417.m02574 MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein /phosphatidylinositol-4-phosphate 5-kinase-related low similarity to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profile PF02493: MORN repeat Length = 471 Score = 26.2 bits (55), Expect = 8.7 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -3 Query: 125 NGLRLVSVETGLRENGHDKIIIKHTLIHYDFNFNKYSVLQ 6 +G + + E G R G K +KH L HY F + + V Q Sbjct: 312 HGCGVYTSEDGSRFVGEFKWGVKHGLGHYHFRMHGFGVYQ 351 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,864,401 Number of Sequences: 28952 Number of extensions: 171354 Number of successful extensions: 419 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 419 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 625471056 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -