BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0082 (682 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0164 + 15265878-15268701,15268782-15269200 30 2.0 07_03_1769 + 29377784-29377878,29377993-29378180,29378340-293784... 29 4.5 01_01_0920 + 7264498-7264573,7264705-7264745,7265339-7265408,726... 29 4.5 01_01_1198 - 9643469-9643585,9643740-9643805,9643905-9644489,964... 28 7.9 >09_04_0164 + 15265878-15268701,15268782-15269200 Length = 1080 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 396 WFKNDSPVYEYDVESNELIDSSPTSI 473 W N + +Y DVE+N L D PTSI Sbjct: 307 WLANCTILYLLDVENNSLADDLPTSI 332 >07_03_1769 + 29377784-29377878,29377993-29378180,29378340-29378472, 29378580-29378715,29378996-29379072,29379162-29380830, 29380935-29381018,29381120-29381224,29381302-29381358 Length = 847 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +3 Query: 372 GSPAPSVHWFKNDSPVYEYDVESNELIDSSPTSIARISSTLIVTRTTSQD 521 GSP P +H F+N++ E ++ SN +SS I ++ T + S++ Sbjct: 233 GSPMPQMHNFQNETSSSELNISSNCSPESSIKVTQDIGASTTGTDSVSEE 282 >01_01_0920 + 7264498-7264573,7264705-7264745,7265339-7265408, 7265500-7265648,7266143-7266238,7266326-7266396, 7266510-7266571,7266651-7266714,7267608-7267692, 7267777-7267903,7268016-7268080,7268739-7268796, 7268927-7269066,7269624-7269693,7269910-7269981, 7270188-7270234,7270468-7270566 Length = 463 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +3 Query: 297 SITQGPLPSYAHTPGTTIELTC--EAAGSPAPSVHWFKNDSPVYE 425 S +GP P+ HT T ++T A S P W K+ +YE Sbjct: 353 STERGPHPNIQHTENITQDMTARKHLAASVLPGAEWRKDGHLLYE 397 >01_01_1198 - 9643469-9643585,9643740-9643805,9643905-9644489, 9645159-9645994,9646597-9646783,9647572-9647737, 9648431-9648520,9649122-9649184,9649277-9649413, 9649835-9650349,9651130-9651231,9651581-9651602 Length = 961 Score = 27.9 bits (59), Expect = 7.9 Identities = 21/75 (28%), Positives = 31/75 (41%), Gaps = 11/75 (14%) Frame = +3 Query: 249 IENGVQAKSDGSHKYLSITQGPLPS-----------YAHTPGTTIELTCEAAGSPAPSVH 395 I NG+ DG +LSIT G L + H PG + +A + +V Sbjct: 249 IRNGI-VSYDGRKLFLSITNGSLVEVTELQPLRWTYHGHPPGGDVSYISDAGNARPGTVF 307 Query: 396 WFKNDSPVYEYDVES 440 + +YE+D ES Sbjct: 308 TVSSTGDLYEFDRES 322 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,377,510 Number of Sequences: 37544 Number of extensions: 313855 Number of successful extensions: 841 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 841 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -