BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0081 (658 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12G12.04 |hsp60|hsp60|mitochondrial heat shock protein Hsp60... 27 1.8 SPBP23A10.14c |ell1||RNA polymerase II transcription elongation ... 27 2.4 SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9... 27 2.4 SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosacch... 27 2.4 SPAC4G9.04c |||cleavage and polyadenylation specificity factor |... 27 3.1 SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||M... 26 5.5 SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pomb... 25 7.3 SPBPJ4664.01 |dps1|SPBPJ694.01|decaprenyl diphosphate synthase s... 25 7.3 SPCC364.07 ||SPCC4G3.01|D-3 phosphoglycerate dehydrogenase |Schi... 25 9.6 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 25 9.6 SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|... 25 9.6 >SPAC12G12.04 |hsp60|hsp60|mitochondrial heat shock protein Hsp60|Schizosaccharomyces pombe|chr 1|||Manual Length = 582 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 317 AKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTVFINSGVL 445 AK G ++ VGG ++ E EK + ++++ A ++ GVL Sbjct: 402 AKLSGGIAVIKVGGSSEVEVNEKKDRIVDALNAVKAAVSEGVL 444 >SPBP23A10.14c |ell1||RNA polymerase II transcription elongation factor SpELL|Schizosaccharomyces pombe|chr 2|||Manual Length = 533 Score = 27.1 bits (57), Expect = 2.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 420 LFSLIPECCWLNNMVSMELTSP 485 L +L+PE W NNM EL +P Sbjct: 227 LQALLPEVAWKNNMNQWELLNP 248 >SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9|Schizosaccharomyces pombe|chr 1|||Manual Length = 1223 Score = 27.1 bits (57), Expect = 2.4 Identities = 17/61 (27%), Positives = 25/61 (40%) Frame = +2 Query: 161 LPLDLDPALSFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAITSLKAKYPGLTV 340 +P+ D T L GY + D L L+ +L I R HD Y + + Y + Sbjct: 1125 MPVPNDEFKKISTILARGYLALDEDESYLPLLSIHLLISRNHDPYLMLNLILKHYLSMIY 1184 Query: 341 L 343 L Sbjct: 1185 L 1185 >SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 297 Score = 27.1 bits (57), Expect = 2.4 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -3 Query: 215 SRTASGCRTTERDRGPTAACGLEIL*HSSCCRSNKVLCC 99 S+ GC +TE+ T+ C E SCC S K CC Sbjct: 257 SQEKKGCCSTEK----TSCCSQE---KKSCCTSEKPSCC 288 >SPAC4G9.04c |||cleavage and polyadenylation specificity factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 638 Score = 26.6 bits (56), Expect = 3.1 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = -2 Query: 483 ARSIPSKPYC--SANSTPELMKTVRACCDSSRRLYFSGSSVSASPPTDNNTVRPG 325 A S PS P S +STP + ++ + + Y +SVS+ PP ++ V PG Sbjct: 277 ATSAPSVPSALSSISSTPFMKPSIPSTIPTIPSAY--SASVSSQPPLTHSYVHPG 329 >SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1258 Score = 25.8 bits (54), Expect = 5.5 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -2 Query: 456 CSANSTPELMKTVRACCDSSRRLYFSGS 373 C NST + M V C D RLY G+ Sbjct: 652 CEFNSTRKRMSIVFRCPDGKIRLYVKGA 679 >SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1428 Score = 25.4 bits (53), Expect = 7.3 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 109 TLLLRQQELCQRISSPHAAVGPRSRSVVLHPLAV 210 TLL++Q+ LC S A+ S S V+ PL + Sbjct: 1045 TLLIKQENLCNNGSLLFEAIEQNSLSKVMIPLNI 1078 >SPBPJ4664.01 |dps1|SPBPJ694.01|decaprenyl diphosphate synthase subunit Dps1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 378 Score = 25.4 bits (53), Expect = 7.3 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = -1 Query: 616 GSETFTVLRFLLIDWRGAECLLNSMPKRSPGRADLLRLNSWELPGEVNSIETILFSQQ 443 G TVLRF + + + N + + SPG +L NS E E + TI +Q Sbjct: 17 GKVRSTVLRFSTTNRNASHLIKNELEQISPGIRQMLNSNS-EFLEECSKYYTIAQGKQ 73 >SPCC364.07 ||SPCC4G3.01|D-3 phosphoglycerate dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 466 Score = 25.0 bits (52), Expect = 9.6 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +2 Query: 275 DRTHDNYRAITSLKAKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTVFINSG 439 D+ D+ + TS + + +GG TEE + YN+ +E +A T +IN G Sbjct: 320 DKFVDSLNSWTSELTHCKNIILTPHIGGS--TEEAQ-YNIGIEVSEALTRYINEG 371 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 25.0 bits (52), Expect = 9.6 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -2 Query: 438 PELMKTVRACCDSSRRLYFSGSSVSASPPTDNNTVRPGYLA 316 P T D S + FSG + S T N+ RP Y+A Sbjct: 117 PNAAATTTTNADGSDKGLFSGLTSSNGYTTGNSYSRPSYVA 157 >SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 767 Score = 25.0 bits (52), Expect = 9.6 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 338 VLLSVGGDADTEEPEKYNLLLESQQARTVFINS 436 ++ VGG+AD + E +LL + +A +N+ Sbjct: 348 IVPQVGGEADVDPKEYMEMLLSTYKASKELVNT 380 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,717,260 Number of Sequences: 5004 Number of extensions: 55004 Number of successful extensions: 171 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 170 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 297805304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -