BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0078 (739 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.15c |ksg1||serine/threonine protein kinase Ksg1|Schizosa... 28 1.6 SPCC1223.12c |meu10||GPI anchored cell surface protein |Schizosa... 26 6.4 SPBC2A9.03 |||conserved protein |Schizosaccharomyces pombe|chr 2... 26 6.4 SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 25 8.5 >SPCC576.15c |ksg1||serine/threonine protein kinase Ksg1|Schizosaccharomyces pombe|chr 3|||Manual Length = 592 Score = 27.9 bits (59), Expect = 1.6 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 153 RVEAKNFRIFLVHTPNRTYYLEDPDSYALEWERVIDE 263 R+ N ++V TP +++ EDP+ A W ++D+ Sbjct: 531 RMVKNNEHGWVVETPTKSWSFEDPNGPASAWVELLDK 567 >SPCC1223.12c |meu10||GPI anchored cell surface protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 416 Score = 25.8 bits (54), Expect = 6.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 94 NSRGPVVRSSIRRLGNRPFRLST 26 NS PV +S ++ +RPFRL T Sbjct: 381 NSTSPVKQSGAAKVDSRPFRLVT 403 >SPBC2A9.03 |||conserved protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 426 Score = 25.8 bits (54), Expect = 6.4 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +3 Query: 132 IPWSPELRVEAKNFRIFLVHTPNRTYYLED--PDSYALEWERVIDE 263 IPW + + KNFR++ +HT + + D P+ +L+ +V E Sbjct: 70 IPWGNKAIGKRKNFRLYRLHTYSLSCNHSDWSPEELSLDTVQVAAE 115 >SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 589 Score = 25.4 bits (53), Expect = 8.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 300 MPALPQTRAEPATLPRPSGPAFYH 371 +PA+ +T P+ +P GP YH Sbjct: 121 LPAVGKTNTFPSQVPNMFGPPLYH 144 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,001,413 Number of Sequences: 5004 Number of extensions: 61708 Number of successful extensions: 128 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 349251756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -