BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0075 (363 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 1.9 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 5.9 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.2 bits (45), Expect = 1.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +1 Query: 4 YQVN*RCNSNCTYRNNG*RNSITNFRDYK 90 Y+ N +C+ TY++NG + N Y+ Sbjct: 144 YKSNLKCDKCSTYQSNGEEVCLENCTGYQ 172 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 20.6 bits (41), Expect = 5.9 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = -1 Query: 246 GTAAEAIASDSIATGQTAKTSTGATRDSEVTGA---GSGTATESLSITAGRTSGA 91 G+ E I S + G+T+ S S + G+ GSG+A S + +TS A Sbjct: 566 GSDEEIINSSNDEGGKTSPNSAVRKCMSPINGSGASGSGSAENLSSGSNNQTSSA 620 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,791 Number of Sequences: 438 Number of extensions: 1303 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8556345 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -