BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0070 (577 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC32F12.15 |tfb5||transcription factor TFIIH complex subunit T... 42 9e-05 SPBC16H5.02 |pfk1||6-phosphofructokinase |Schizosaccharomyces po... 26 4.5 SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein... 25 6.0 SPBC1347.04 |tim54||TIM22 inner membrane protein import complex ... 25 6.0 >SPBC32F12.15 |tfb5||transcription factor TFIIH complex subunit Tfb5 |Schizosaccharomyces pombe|chr 2|||Manual Length = 68 Score = 41.5 bits (93), Expect = 9e-05 Identities = 20/71 (28%), Positives = 42/71 (59%), Gaps = 1/71 (1%) Frame = +2 Query: 74 MVNVMKGVL-VECDPAMKQFLLHLDETLALGRKFILQDLDETHLFISADIVETLQARVDD 250 M KG+L VECDP +KQ +L++DE +++++DE L ++ +E ++A ++ Sbjct: 1 MPRAQKGLLLVECDPTVKQLILNMDEQ---SPGIVIEEIDEERLLVNESRLEQVKAELER 57 Query: 251 LMDQLSIPVHD 283 +++ + V + Sbjct: 58 RLEENTYQVEE 68 >SPBC16H5.02 |pfk1||6-phosphofructokinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 942 Score = 25.8 bits (54), Expect = 4.5 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -2 Query: 573 SCANVFRNRIL*YSALLDFFFLVGFSLESANFGTFFDITKSACGSS 436 SC +V N Y+ LDF+ +GF + A+FGT C S Sbjct: 10 SCYSVVANTEDTYNQTLDFYQKLGFK-KVASFGTSDSDNARVCNES 54 >SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 670 Score = 25.4 bits (53), Expect = 6.0 Identities = 17/66 (25%), Positives = 30/66 (45%) Frame = -2 Query: 516 FFLVGFSLESANFGTFFDITKSACGSS*KLSCSRASTAFLARRFLATSSKTFLLSASLTL 337 F++VG S+ G+ F + S + AST+ + T++ T SA+ + Sbjct: 111 FYIVGGEGISSTTGSTFQSMTTFTSSQTNSGHASASTSIPSTAITVTANSTIYSSATSSF 170 Query: 336 PDSREV 319 P S +V Sbjct: 171 PYSTDV 176 >SPBC1347.04 |tim54||TIM22 inner membrane protein import complex subunit Tim54|Schizosaccharomyces pombe|chr 2|||Manual Length = 347 Score = 25.4 bits (53), Expect = 6.0 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 122 KQFLLHLDETLALGRKFILQDLDETHLFISADIVETLQARVD 247 KQF D + LQD DE F + DI ++ +A+ D Sbjct: 303 KQFFTRSDLENRIWTAPFLQDSDEIRFFENIDIFDSTKAKQD 344 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,376,678 Number of Sequences: 5004 Number of extensions: 47274 Number of successful extensions: 136 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -