BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0069 (403 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||M... 26 1.9 SPAC23H3.06 |apl6||AP-3 adaptor complex subunit Apl6 |Schizosacc... 26 1.9 SPBC1604.19c |||TRAPP complex subunit Trs85 |Schizosaccharomyces... 26 1.9 >SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||Manual Length = 757 Score = 26.2 bits (55), Expect = 1.9 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 307 PKTTITNRVSLARLSDGSKNVLLLFQNFHNXVEP 206 PKT +T +S + S S +L QNF+N P Sbjct: 577 PKTNLTRSLSYSEQSFDSGVSILSCQNFYNIFHP 610 >SPAC23H3.06 |apl6||AP-3 adaptor complex subunit Apl6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 745 Score = 26.2 bits (55), Expect = 1.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 131 ETKYDKNSYTRKLATRTLNITRAP 202 +T YDKN TR A R ++ R P Sbjct: 113 KTLYDKNPLTRSTAIRVMSSIRVP 136 >SPBC1604.19c |||TRAPP complex subunit Trs85 |Schizosaccharomyces pombe|chr 2|||Manual Length = 658 Score = 26.2 bits (55), Expect = 1.9 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -1 Query: 280 SLARLSDGSKNVLLLFQNFHNXVEPXWRARYV*RARSEFSC 158 S SD +K + + +N P WR+ +A SE SC Sbjct: 314 SFCSSSDDAKPITFVTKNLRKFPIPEWRSSLEVQAESEQSC 354 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,074,365 Number of Sequences: 5004 Number of extensions: 15256 Number of successful extensions: 31 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 136158338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -