BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0069 (403 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0345 + 7664564-7665277,7665672-7665921,7665996-7666015 26 9.7 >03_02_0345 + 7664564-7665277,7665672-7665921,7665996-7666015 Length = 327 Score = 26.2 bits (55), Expect = 9.7 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = -1 Query: 403 WLVPRS*SVALTRSALRVRTRRYVLFYLIKI*PKTTITNRVS 278 WLV R + +TR+A + R++++ L + P + +T R S Sbjct: 260 WLVARIRKIVMTRAADQTILRKHLIQRLRRFQPSSFLTFRTS 301 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,280,028 Number of Sequences: 37544 Number of extensions: 79875 Number of successful extensions: 125 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 694697784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -