BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0067 (641 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59930.1 68418.m07515 DC1 domain-containing protein / UV-B li... 30 1.5 >At5g59930.1 68418.m07515 DC1 domain-containing protein / UV-B light-insensitive protein, putative similar to ULI3 (UV-B light insensitive) [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 656 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 526 VLECFLCSVAFTGMRIKY*EKDETFLEKHLVS-KEPF 633 VL+C LC + FTG K E+ ++ ++ H S EPF Sbjct: 446 VLDCKLCGMFFTGFEYKSQERRQSDIDVHCGSLTEPF 482 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,107,079 Number of Sequences: 28952 Number of extensions: 158522 Number of successful extensions: 287 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 287 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -