BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0066 (690 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC757.11c |||membrane transporter|Schizosaccharomyces pombe|ch... 27 3.4 SPBC1718.04 |||glycerol-3-phosphate O-acyltransferase |Schizosac... 25 7.8 SPAC23C11.01 |||ER membrane protein, ICE2 family|Schizosaccharom... 25 7.8 >SPCC757.11c |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 471 Score = 26.6 bits (56), Expect = 3.4 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 537 YIRYYFGDWKILVLYGAFLDIALPIIHIAYHY 442 Y+ Y D I++L G L+I +IHI HY Sbjct: 339 YLTRYLTDRDIILL-GCCLNIVCMVIHITIHY 369 >SPBC1718.04 |||glycerol-3-phosphate O-acyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 675 Score = 25.4 bits (53), Expect = 7.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 347 YHHPAYFRREAVMRFGS 397 Y HP FR AV+ FGS Sbjct: 249 YFHPHRFRSRAVLEFGS 265 >SPAC23C11.01 |||ER membrane protein, ICE2 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 441 Score = 25.4 bits (53), Expect = 7.8 Identities = 11/38 (28%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +3 Query: 516 LQNNILYIHYVKTS-QGIKELIKRLFI*LLKNSVFLVH 626 +QNNI+++ Y +TS QG+ ++ + + ++ L H Sbjct: 348 IQNNIIFLEYSRTSKQGMWSILSPCILIAVYTNLLLQH 385 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,643,820 Number of Sequences: 5004 Number of extensions: 50744 Number of successful extensions: 100 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -