BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0066 (690 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC087079-4|ABC48239.1| 370|Caenorhabditis elegans Hypothetical ... 29 4.1 AC024791-37|AAF60671.1| 196|Caenorhabditis elegans Hypothetical... 29 4.1 >AC087079-4|ABC48239.1| 370|Caenorhabditis elegans Hypothetical protein Y37E3.5a protein. Length = 370 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = -1 Query: 441 PANFCREAVTATPPFEPKRITASRRK---*AGWWYLPVRTPQRSYNQ*SHIMSL 289 P NFCR + T+T P P+ + ++LP + P R Y++ I ++ Sbjct: 309 PVNFCRISQTSTKPVSPESNSVKEEPTIILKDNYFLPPKAPGRQYSRIQRIQNV 362 >AC024791-37|AAF60671.1| 196|Caenorhabditis elegans Hypothetical protein Y47G6A.26 protein. Length = 196 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 450 YHYPANFCREAVTATPPFEPKRITASRRK 364 Y Y NFCRE V + F PK + + ++ Sbjct: 150 YRYDQNFCREFVGISEAFSPKSLENAEKE 178 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,422,079 Number of Sequences: 27780 Number of extensions: 280156 Number of successful extensions: 444 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 444 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1581836700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -