Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0061
         (392 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated...    24   0.72 
DQ855485-1|ABH88172.1|  128|Apis mellifera chemosensory protein ...    21   5.1  
AJ973400-1|CAJ01447.1|  128|Apis mellifera hypothetical protein ...    21   5.1  

>DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 469

 Score = 23.8 bits (49), Expect = 0.72
 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 2/69 (2%)
 Frame = +2

Query: 137 LIPSAAKFLAGNTI--TKVTAPVVATNAKYSTKKEATFEIKPYKLHKLDQGPATSATLTS 310
           L  +  +F   NTI   K T P+   N+KY  K   T ++   +  K   G   S + +S
Sbjct: 305 LFAAMVEFAFVNTIYRRKKTVPLKKVNSKYILKSTLTPKLARKQFQKNTTGLERSRSWSS 364

Query: 311 EDALKLYEQ 337
            D     +Q
Sbjct: 365 LDNTNTNDQ 373


>DQ855485-1|ABH88172.1|  128|Apis mellifera chemosensory protein 4
           protein.
          Length = 128

 Score = 21.0 bits (42), Expect = 5.1
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = +1

Query: 181 ESDCTGCSDKRK 216
           E++C+ CS+K+K
Sbjct: 72  ENECSPCSEKQK 83


>AJ973400-1|CAJ01447.1|  128|Apis mellifera hypothetical protein
           protein.
          Length = 128

 Score = 21.0 bits (42), Expect = 5.1
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = +1

Query: 181 ESDCTGCSDKRK 216
           E++C+ CS+K+K
Sbjct: 72  ENECSPCSEKQK 83


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 108,948
Number of Sequences: 438
Number of extensions: 2148
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used:  9638226
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)