BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0058 (781 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine p... 24 4.6 AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine p... 24 4.6 AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine p... 24 4.6 AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 pr... 24 6.1 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 8.0 >AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 212 SHCFHYLLGEYQPA 171 SHCF Y+L E PA Sbjct: 12 SHCFQYILTEGPPA 25 >AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 protein. Length = 276 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/69 (15%), Positives = 28/69 (40%), Gaps = 2/69 (2%) Frame = -3 Query: 332 IAMTDSGLLQT*AYKVLQNQYMTQRMFPNPRWGFQRRSIPSHCFHYLLG--EYQPALVQL 159 + + S +L +Y+V++ ++ Q + R + C+ + + E +L+ Sbjct: 41 LQLCQSTVLHRESYQVVKRDFLQQLLEMKANGALDMRQVAGQCYSFFIAGFETSASLLSF 100 Query: 158 CSFRTLLEG 132 C + G Sbjct: 101 CLYELAKHG 109 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 8.0 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 Query: 623 HNLDNGHPNHHG 588 H+L +GH +HHG Sbjct: 1316 HHLHHGHHHHHG 1327 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 760,630 Number of Sequences: 2352 Number of extensions: 14918 Number of successful extensions: 76 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -