BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0050 (509 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55929| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_39863| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_27977| Best HMM Match : ARID (HMM E-Value=1.6e-26) 27 6.8 SB_21583| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 >SB_55929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/36 (30%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +3 Query: 219 LNYFLSYQYCRSLGLQLA-SFETKEKADSITTYLTN 323 L+YF+++ YCR + L +T E + ++ + +TN Sbjct: 591 LSYFVAFVYCRKINRSLTMGVDTAEMSGAVVSGITN 626 >SB_39863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2978 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +3 Query: 183 YFISRMNPYSPELNYFLSYQYCRSLGLQLASFETKEKADSI 305 +FI+ NPY + + LG + S ETKEK I Sbjct: 2473 HFIAACNPYRKHTDQMIHKLESAGLGYHVTSQETKEKLGKI 2513 >SB_27977| Best HMM Match : ARID (HMM E-Value=1.6e-26) Length = 1536 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/55 (25%), Positives = 23/55 (41%) Frame = -3 Query: 402 DRCSSTKTCLCRGYYPMSRSHICCNLHLLDKSLSNLPSPSSRTMPVEDLMICSTD 238 D C K + P S+ I CN + S + + M ++D ++CS D Sbjct: 954 DACQPDKITCSKDNVPCSKDDITCNKDSIACSRERVACLNDNVMCLKDNVMCSKD 1008 >SB_21583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 27.1 bits (57), Expect = 9.0 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -3 Query: 381 TCLCRGYYPMSRSHICCNLHLLDKSLSNLPSPSSRTMPVEDLMICST 241 TCLC + + H C H++ P PS TM + DL+ +T Sbjct: 191 TCLCSHSNTLPKYHNCIGGHIIG-CFDPYPDPSQFTM-IRDLVTSAT 235 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,663,876 Number of Sequences: 59808 Number of extensions: 349367 Number of successful extensions: 783 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1123894172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -