BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0049 (517 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 1.4 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 21 5.7 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 5.7 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 5.7 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 5.7 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 5.7 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 5.7 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 5.7 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 5.7 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 5.7 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 5.7 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 5.7 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 5.7 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 5.7 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 5.7 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 5.7 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.4 bits (48), Expect = 1.4 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 57 SVSDTPSLKDLPKVATDLKS 116 SVS PS+K + K ATD S Sbjct: 156 SVSCVPSVKHVAKCATDFSS 175 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = +3 Query: 105 DLKSQLEGFNTSCLRDVDTNEKIV 176 +LKS L + C++++ T ++I+ Sbjct: 21 ELKSGLHTVQSVCMKEIGTAQQII 44 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 5.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 227 RRYREV*FEPAEAHRDSGEEPASGQRRYRSGEGKEQIP 340 R YRE E RD E S + R EQIP Sbjct: 54 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 5.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 227 RRYREV*FEPAEAHRDSGEEPASGQRRYRSGEGKEQIP 340 R YRE E RD E S + R EQIP Sbjct: 54 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 5.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 227 RRYREV*FEPAEAHRDSGEEPASGQRRYRSGEGKEQIP 340 R YRE E RD E S + R EQIP Sbjct: 54 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 5.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 227 RRYREV*FEPAEAHRDSGEEPASGQRRYRSGEGKEQIP 340 R YRE E RD E S + R EQIP Sbjct: 54 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 5.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 227 RRYREV*FEPAEAHRDSGEEPASGQRRYRSGEGKEQIP 340 R YRE E RD E S + R EQIP Sbjct: 54 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 5.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 227 RRYREV*FEPAEAHRDSGEEPASGQRRYRSGEGKEQIP 340 R YRE E RD E S + R EQIP Sbjct: 54 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 5.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 227 RRYREV*FEPAEAHRDSGEEPASGQRRYRSGEGKEQIP 340 R YRE E RD E S + R EQIP Sbjct: 54 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 91 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 5.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 227 RRYREV*FEPAEAHRDSGEEPASGQRRYRSGEGKEQIP 340 R YRE E RD E S + R EQIP Sbjct: 303 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 340 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 5.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 227 RRYREV*FEPAEAHRDSGEEPASGQRRYRSGEGKEQIP 340 R YRE E RD E S + R EQIP Sbjct: 303 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 340 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 5.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 227 RRYREV*FEPAEAHRDSGEEPASGQRRYRSGEGKEQIP 340 R YRE E RD E S + R EQIP Sbjct: 303 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 340 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 5.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 227 RRYREV*FEPAEAHRDSGEEPASGQRRYRSGEGKEQIP 340 R YRE E RD E S + R EQIP Sbjct: 303 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 340 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 5.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 227 RRYREV*FEPAEAHRDSGEEPASGQRRYRSGEGKEQIP 340 R YRE E RD E S + R EQIP Sbjct: 303 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 340 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 5.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 227 RRYREV*FEPAEAHRDSGEEPASGQRRYRSGEGKEQIP 340 R YRE E RD E S + R EQIP Sbjct: 303 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 340 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 5.7 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 227 RRYREV*FEPAEAHRDSGEEPASGQRRYRSGEGKEQIP 340 R YRE E RD E S + R EQIP Sbjct: 303 REYREYRETSRERSRDRRERGRSREHRIIPSHYIEQIP 340 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,614 Number of Sequences: 438 Number of extensions: 2843 Number of successful extensions: 16 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -