BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0046 (569 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 25 0.60 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 24 1.0 DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 21 9.8 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 24.6 bits (51), Expect = 0.60 Identities = 13/48 (27%), Positives = 25/48 (52%), Gaps = 8/48 (16%) Frame = +1 Query: 307 ISIHGRESNNL--ARILQTYYET------SHHPSLIWACVPMLCSRTY 426 I ++ ++++NL +++L TY + SH P W C+ C R + Sbjct: 22 IYLYWQQTSNLTTSKLLYTYRQPYPRQKKSHPPQWTWQCINQRCERRH 69 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.8 bits (49), Expect = 1.0 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +1 Query: 337 LARILQTYYETSHHPSLIWACVPMLCSR 420 L ++ T YE +H +++W+C C R Sbjct: 241 LTYLIWTIYEM-YHLAILWSCTSTNCPR 267 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 20.6 bits (41), Expect = 9.8 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 469 HSKLSLLHHLQCIL 428 HSK LL+++ C+L Sbjct: 48 HSKRLLLNYINCLL 61 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,942 Number of Sequences: 336 Number of extensions: 3105 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14099535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -