BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0046 (569 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 2.8 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 3.7 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 8.6 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 8.6 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 22.6 bits (46), Expect = 2.8 Identities = 15/48 (31%), Positives = 20/48 (41%) Frame = +2 Query: 395 HVYLCYVVEHIXNALKMMKKRKLGMSPGTGGPNSMSALIGINVLVLFW 538 H + Y I M +KRK G + + A+IG L LFW Sbjct: 177 HTFGAYFGLAISFVFGMKEKRKEHHLEGPSYNSDIFAMIGTIFLWLFW 224 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 3.7 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 532 QHQHVYPNQGAH 497 QH H+ P QG H Sbjct: 175 QHPHMQPQQGQH 186 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/47 (21%), Positives = 20/47 (42%) Frame = -2 Query: 448 HHLQCILYMFYYIA*VHMPILETDGGSFHNKFGEFWLNCCSLSRVLI 308 H + + + YY V +++ G +F N + L R+L+ Sbjct: 66 HQYKNPIIVMYYAGAVKAGLVQPQGTTFSNSISQLRKEVSLLYRILL 112 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -1 Query: 557 EDLQNNSKTTPTRLSQS 507 ED++NNS+ + +R +S Sbjct: 383 EDVENNSEVSKSRTKES 399 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,141 Number of Sequences: 438 Number of extensions: 3572 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -