BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0045 (646 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 25 2.0 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 25 2.0 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 24 4.7 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 24 4.7 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 24 4.7 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 4.7 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 24 4.7 AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. 23 6.3 AF513639-1|AAM53611.1| 195|Anopheles gambiae glutathione S-tran... 23 8.3 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 25.0 bits (52), Expect = 2.0 Identities = 8/27 (29%), Positives = 19/27 (70%) Frame = +2 Query: 92 FPNESEKNGKCSSAEYKLEGDVVKVKN 172 + ++ E++ ++AE+ L+ DV++V N Sbjct: 170 YDDDDEEDAAAAAAEFPLQKDVIRVTN 196 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 25.0 bits (52), Expect = 2.0 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +3 Query: 99 TNLRRTANALQLNTNWKVTW*RSRTCISSTASRSI*KGRPSSPTTP 236 T LR T L+ T W + T ++T ++ S+PTTP Sbjct: 99 TTLRPTTTTLRPTTTTTTDWITTTTTEATTTTKFPTTTTTSAPTTP 144 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.7 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +3 Query: 99 TNLRRTANALQLNTNWKVTW*RSRTCISSTASRSI*KGRPSSPTTP 236 T LR T L+ T W + T ++T + S+PTTP Sbjct: 99 TTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTP 144 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.7 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +3 Query: 99 TNLRRTANALQLNTNWKVTW*RSRTCISSTASRSI*KGRPSSPTTP 236 T LR T L+ T W + T ++T + S+PTTP Sbjct: 99 TTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTP 144 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.7 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +3 Query: 99 TNLRRTANALQLNTNWKVTW*RSRTCISSTASRSI*KGRPSSPTTP 236 T LR T L+ T W + T ++T + S+PTTP Sbjct: 99 TTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTP 144 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.7 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +3 Query: 99 TNLRRTANALQLNTNWKVTW*RSRTCISSTASRSI*KGRPSSPTTP 236 T LR T L+ T W + T ++T + S+PTTP Sbjct: 99 TTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTP 144 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.7 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +3 Query: 99 TNLRRTANALQLNTNWKVTW*RSRTCISSTASRSI*KGRPSSPTTP 236 T LR T L+ T W + T ++T + S+PTTP Sbjct: 99 TTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTP 144 >AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. Length = 226 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 Query: 254 TVTFKFGEISRDGSVQVLATDYNNYAIAYNCKYDD 358 T+TFK G+ LATDY + + + D Sbjct: 53 TLTFKDGQTYTQAIAFTLATDYGTVRLMSSYNFTD 87 >AF513639-1|AAM53611.1| 195|Anopheles gambiae glutathione S-transferase S1-2 protein. Length = 195 Score = 23.0 bits (47), Expect = 8.3 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -3 Query: 458 VFIDEIIDSSFSVAFKLLVSREDPDDTLDE 369 + ID ++D+ K+ V +PDD + E Sbjct: 78 LMIDTVVDTVNDFRLKIAVVSYEPDDEIKE 107 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 607,530 Number of Sequences: 2352 Number of extensions: 11228 Number of successful extensions: 27 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63559560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -