BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0040 (431 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0010 + 72162-74303,74470-74545,75971-76043,76496-76540,779... 27 4.9 02_01_0108 - 789597-790224,790441-790570,790946-791081 27 4.9 01_03_0282 - 14580875-14580891,14582126-14585855 27 4.9 05_07_0287 + 28993615-28995617,28996464-28996524,28996603-28996830 27 8.6 02_05_0623 + 30446420-30446525,30446635-30446715,30446811-304469... 27 8.6 01_06_0715 + 31416338-31416500,31416601-31416710,31416808-314168... 27 8.6 >07_01_0010 + 72162-74303,74470-74545,75971-76043,76496-76540, 77916-78116,78463-78541,78637-78678,78788-78847, 79087-80484,80777-80902,81037-81300 Length = 1501 Score = 27.5 bits (58), Expect = 4.9 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -1 Query: 200 REHIQNLSTLGSHTTE*QRTTHSRLYTTTQDNSRKTQTQLHTHTIYTQ 57 +EHI N +++ + + HS L+ T + SR+ + H Y Q Sbjct: 1087 QEHINNYTSVNDYAVTSNPSFHSELHKTLEPISREEREDCMWHIRYRQ 1134 >02_01_0108 - 789597-790224,790441-790570,790946-791081 Length = 297 Score = 27.5 bits (58), Expect = 4.9 Identities = 15/52 (28%), Positives = 19/52 (36%) Frame = -3 Query: 300 RVSVEQAREPGRVTARRRLQQRCGQTHSPSLHHSRTHPKPFHLRFTHDGITT 145 RV Q P + A T PSLHH HP ++ + TT Sbjct: 116 RVMQAQGSIPNNLAAAAAEVTSMSTTEPPSLHHHHHHPHHHQIKNSSGSTTT 167 >01_03_0282 - 14580875-14580891,14582126-14585855 Length = 1248 Score = 27.5 bits (58), Expect = 4.9 Identities = 14/56 (25%), Positives = 25/56 (44%) Frame = -2 Query: 181 FPP*VHTRRNNNAQLIPAYTQQHRTIHAKHKHNYTHTQFIHSFKRHKLNTQVLFIY 14 FP + + A IP + + I AKH H+ + HS+ +L ++ +Y Sbjct: 568 FPQHLLKYNSLRALCIPNFRGRPCLIQAKHLHHLRYLNLSHSWNMERLPEEISILY 623 >05_07_0287 + 28993615-28995617,28996464-28996524,28996603-28996830 Length = 763 Score = 26.6 bits (56), Expect = 8.6 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -3 Query: 273 PGRVTARRRLQQRCG 229 PG+ TAR+++Q RCG Sbjct: 253 PGKCTARKQIQVRCG 267 >02_05_0623 + 30446420-30446525,30446635-30446715,30446811-30446987, 30447629-30447799,30448239-30448448,30448634-30448722, 30449318-30450010 Length = 508 Score = 26.6 bits (56), Expect = 8.6 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 3/57 (5%) Frame = -3 Query: 372 RPKSLRVGHKKLFVTDLIGSI---DVSRVSVEQAREPGRVTARRRLQQRCGQTHSPS 211 RP+ R+ H K F D G+I D +++ + + G T R G PS Sbjct: 142 RPREARMNHPKGFTVDGRGNIYVADAMNMAIRKISDTGVTTIAGGKSSRGGHVDGPS 198 >01_06_0715 + 31416338-31416500,31416601-31416710,31416808-31416880, 31416988-31417135,31417867-31418133,31418234-31418576, 31418665-31418802,31419389-31419514,31419626-31419838, 31419918-31420164,31420247-31420446,31420538-31420891, 31420984-31421568 Length = 988 Score = 26.6 bits (56), Expect = 8.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 140 LCVVIPSCVNLRWKGFGCVLE*WSEGEWVW 229 + +++ S + LRW G G +E W E W Sbjct: 808 ISIIVTSVLELRWSGIG--IEDWWRNEQFW 835 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,867,767 Number of Sequences: 37544 Number of extensions: 135365 Number of successful extensions: 463 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 814473264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -