BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0038 (337 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 24 0.43 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 1.7 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 1.7 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 1.7 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 22 2.3 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 21 3.0 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 20 7.0 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 20 9.2 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 20 9.2 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 24.2 bits (50), Expect = 0.43 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 314 HTLKGECRHMLLHHWPFLFESS 249 HT + +C H LL H P L + S Sbjct: 330 HTPEPDCIHELLGHMPLLADPS 351 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 22.2 bits (45), Expect = 1.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -1 Query: 262 SLNPLNVYNKLF 227 S+NP+NVY K + Sbjct: 35 SINPINVYTKAY 46 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 1.7 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = +1 Query: 277 CNSICRHSPFKVCDCQV 327 C ++C F CDC++ Sbjct: 743 CFALCHCCDFDACDCEM 759 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 1.7 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -1 Query: 175 YNLNFIVFANRHGFYI 128 YN +FI++++ FYI Sbjct: 339 YNTDFIIYSSLSSFYI 354 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.8 bits (44), Expect = 2.3 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 275 HWPFLFESSQCIQQTF 228 H+P++F + CI Q+F Sbjct: 117 HFPYVFGEAFCIIQSF 132 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 21.4 bits (43), Expect = 3.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 40 KQEEAFQCSFTYKASVDVLS 99 K + FQC YK D+L+ Sbjct: 115 KISKIFQCFMKYKTITDILN 134 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 20.2 bits (40), Expect = 7.0 Identities = 7/34 (20%), Positives = 21/34 (61%) Frame = +2 Query: 146 IRKDDEVQVVRGHYKGQQVGKVMQVYRKKFVVYI 247 +++DD+V++V ++ Q + ++ + ++YI Sbjct: 384 VQEDDDVKLVLLNFGWQMICLIVVIALVSIIMYI 417 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 19.8 bits (39), Expect = 9.2 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = +3 Query: 237 LYTLRGFKEKRPMVQQHM 290 L ++ G+K P++Q+H+ Sbjct: 306 LLSVLGYKYITPLIQKHL 323 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 19.8 bits (39), Expect = 9.2 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -1 Query: 214 HHFANLLAFVVSTYNLNFI 158 H NL +S++NLN++ Sbjct: 257 HKTQNLYYSAMSSHNLNYV 275 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,651 Number of Sequences: 438 Number of extensions: 1601 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7591023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -