BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0034 (682 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces po... 26 5.8 SPCC1259.08 |||conserved fungal protein|Schizosaccharomyces pomb... 25 7.7 >SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 25.8 bits (54), Expect = 5.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 131 LVSREYYRPWRHLAAAARDLGSSIKSDKDKFQV 229 L++ Y + W+ L++ + + S SDKD Q+ Sbjct: 358 LLNGRYKKRWQQLSSEVKKISDSASSDKDVKQL 390 >SPCC1259.08 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 394 Score = 25.4 bits (53), Expect = 7.7 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 270 LKRRTATSWLKANTRRRKISMVTYRVNSLVATLCR 374 LKR S+ ANT RK ++V +AT C+ Sbjct: 126 LKRPAKVSFALANTPSRKGNLVPQSPRRTIATTCK 160 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,728,419 Number of Sequences: 5004 Number of extensions: 56117 Number of successful extensions: 131 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -